(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE315

PENCW_16.PE315       Location/Qualifiers
FT   CDS_pept        join(complement(721280..721363),complement(721168..721224),
FT                   complement(720867..721103),complement(720326..720814),
FT                   complement(719670..720272))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948860"
FT                   /orf_name="Pc20g03150"
FT                   /product="Pc20g03150 protein"
FT                   /protein_id="CAP85644.1"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI0001831C86"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP6"
FT                   /transl_table=1
FT                   /translation="MSGGLLKPEKDFTKDADKLIPEAEALAKTDVQGAVDKLLGLEKQS
FT                   RQASDLATTSRLLIAIVTISKNSGDWNLLNDQVLLLSKKHAQLKQATTKMVQTVMTFLD
FT                   ETPNLEVKMSVIETLRTVTEGKIFVEVERARVTRILSNIKKTQGDLTSAADILCELQVE
FT                   TFGSMTRREKTEFILEQVSLCIERGDWTQAQILSRKINKRYFSRKPKKSAEQIETLKKE
FT                   AEEREKTRAPDEPPMEVDDDVTDLKLRYFEQQIILANHDNKYLEVCKNYREVLDTEAVE
FT                   NNPEHLRASLARIVYYVVLSPYDNEQSDLLHRIKQDSRLSQIPEESRLLKLFTIPELMR
FT                   WPMVAEQFGPHLCSTDVFDAEAKQSTENQANQRWQDLRKRVIEHNVRVVAKYYTRIQMG
FT                   RLTQLLDLTEEETEKYISDLVTSKTIYAKIDRPARLVNFAKPRDADDVLNEWSSDMKNL
FT                   LGLLERIDHLITKEEMMARIQPTRSDKGKAH"
     atgtccggcg gcctgctgaa gcccgagaag gacttcacca aggatgccga caagctcatc        60
     ccggaggcgg aggctctcgc aaagactgat gtccagggag cagtcgataa gctgttgggg       120
     ttggagaagc aatccagaca ggcttccgat ctcgccacta catcgcggct gctgattgcc       180
     attgtcacca tcagcaagaa ctccggcgac tggaaccttc tgaacgacca agtactgctc       240
     ctctctaaga aacatgccca actcaagcag gccacaacga agatggtgca gacggtgatg       300
     acattcctgg atgagacacc caacttggag gttaagatgt ccgttattga aactctgcgc       360
     acagtgactg agggaaagat ctttgttgaa gtagagcgag cccgcgttac ccgcatactt       420
     tcaaatatca agaagactca aggtgatctc acttcggcag cagatatcct gtgtgagttg       480
     caggtggaga cattcgggtc aatgacgaga cgggaaaaga cagaattcat cctggagcag       540
     gtctctttgt gcattgagcg cggagactgg acccaggctc agattctcag ccgcaagatc       600
     aacaagcggt acttcagccg caagccgaag aagtcggccg agcagatcga gacgctcaag       660
     aaggaggcag aggagcgaga gaagacccgt gcgcctgatg aaccacctat ggaggtggac       720
     gacgacgtca cagatctcaa gcttcgttac ttcgaacagc agattatctt ggccaaccat       780
     gataacaaat atctcgaggt ttgcaagaac taccgggaag tcctggacac ggaagcagtt       840
     gagaacaacc cagagcacct gcgtgcctca ctcgcccgca ttgtgtacta tgttgtcctg       900
     tctccctacg ataatgagca atccgatctc ttgcaccgca tcaagcaaga ctcgcggctg       960
     tcacaaatcc ccgaggaatc ccgcttgttg aagctgttca ccattcctga gctgatgcgc      1020
     tggcctatgg tcgccgagca gtttggcccc cacctgtgca gcacagacgt gttcgacgcc      1080
     gaggcgaagc agtctactga gaaccaagca aaccagaggt ggcaagacct gcggaagcgt      1140
     gtcatcgagc acaatgtccg tgtagtggcc aagtactata ctcgcatcca gatgggccgt      1200
     ctgacccaac ttttggatct gaccgaggaa gagacggaga agtacattag tgacctggtc      1260
     acatcaaaga ccatctacgc taagatcgac cgacctgcgc ggttggtcaa ctttgccaaa      1320
     ccccgggatg cggatgacgt gctgaacgag tggagcagcg acatgaagaa tctgctgggt      1380
     ctgctcgagc ggatcgacca tctgatcacc aaggaggaga tgatggcccg tatccagccc      1440
     actcgcagtg acaagggcaa ggcgcattga                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page