(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE316

PENCW_16.PE316       Location/Qualifiers
FT   CDS_pept        join(722482..722806,722860..724223)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948861"
FT                   /orf_name="Pc20g03160"
FT                   /product="Pc20g03160 protein"
FT                   /function="binding"
FT                   /function="uroporphyrin-III C-methyltransferase activity "
FT                   /biological_process="siroheme biosynthetic process "
FT                   /protein_id="CAP85645.1"
FT                   /db_xref="GO:0004851"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0019354"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012066"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831C87"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP7"
FT                   /transl_table=1
FT                   /translation="MKDASCDPKPPVPLMAAWNTESQVHLIVGSNPLAAARCARSLEVG
FT                   ATPIIIAPETDDMHFTLSEHIANGSAQWIRHEFEDKDLTTLGREEVDHIVDLVFVTLGS
FT                   NNSLSPHISKLCRRLRIPVNVSDAPELCSFTLLSTYSDGPLHIGITTSGRGCKLASRLR
FT                   REIASFLPQNLGTAIDRLGAVRRRLWEEDSAAGLIEGIFDREDDDSTGQKHTFNNLVTE
FT                   GDAAAAKTRRVRWLSQICEYWPLRKLVSITDADMDAILKAYTAGNDTTNGTNGLDALSK
FT                   KGKIVLAGSGPGHPDLLTRATYHAIHNADIILADKLVPAPVLDLIPRRTEVHIARKFPG
FT                   NADQAQEEFLVMGLAALKQGRQVLRLKQGDPYLYGRGAEEFEFFRKEGYSPVVLPGITS
FT                   AMSASLFADIPATHRGVSDQVLVCTGTGRKGAAPNPPTYVPTQTVVFLMALHRLSALVE
FT                   SLTTFPAEDTGPQSRTLWPKETPCAIVERASCPDQRVIRSTLEHVCLAFEEAGSRPPGL
FT                   LVVGASCHVLHNPQGQRWVIEEGFHGLDELRSEVDVVAVSMDEKQ"
     atgaaggacg cctcatgcga tcccaaacca ccggtgccat tgatggctgc gtggaataca        60
     gaatcacaag tccacttgat cgtcggttca aatcctcttg ctgccgctcg atgtgcgagg       120
     agcctggagg tcggcgcaac gccgatcatc attgcgccgg agaccgatga catgcacttc       180
     acactatctg aacacattgc caatggctct gcccagtgga ttcgtcatga attcgaagac       240
     aaggacttga caaccctagg tagagaagaa gtcgatcaca ttgtcgactt ggtctttgtc       300
     actttgggta gcaacaactc attaagtcca cacatatcga agctctgccg gcgtctcaga       360
     atcccagtga atgtatcaga tgctcccgaa ctatgctcct tcaccctact ttccacctac       420
     tcggacggcc ctctacacat tggaatcact acttccggcc gcggatgcaa gcttgcatct       480
     cggctgcgga gagagattgc ctctttccta cctcaaaacc ttggaacggc catcgacaga       540
     cttggtgctg tgaggaggcg gctgtgggaa gaggacagtg ctgctgggct aatagaaggc       600
     atatttgaca gagaggacga cgatagtaca ggccaaaaac acaccttcaa caacttggtc       660
     acagaaggcg atgctgccgc cgcgaagaca agaagggtgc gttggctgtc tcaaatctgt       720
     gaatactggc ctctccggaa gctcgtgtct atcaccgatg ccgatatgga tgccatcctg       780
     aaggcctata cagctggcaa tgacaccaca aatggcacca acggcctcga cgccctctca       840
     aagaagggga agatcgtgct tgcaggctct ggtcccggtc atccagacct actcacccgc       900
     gccacctacc acgcaatcca taatgccgac atcatcctcg ctgacaagct cgtccccgct       960
     ccagtcctgg acttgatccc tcgccgaacg gaagtccaca ttgcgcgcaa gttccctggc      1020
     aacgcagacc aggcgcagga ggaattcctc gtgatgggtt tagcagcttt aaagcaggga      1080
     cggcaagtcc tgcgcttgaa acaaggagac ccatatctat atggacgtgg agcggaagag      1140
     ttcgagttct tcaggaagga gggttattct ccggtcgtgt tgccgggcat caccagcgct      1200
     atgagtgctt ccctcttcgc cgatatccca gcaacccacc gcggcgtctc cgaccaggtc      1260
     cttgtgtgca caggaactgg cagaaaggga gctgctccaa accctcccac ttatgtacct      1320
     acccagactg tggtgttcct catggctctt caccgacttt ctgctcttgt ggagtcgctc      1380
     actaccttcc ccgcggaaga cactggtccg caatcacgca cactctggcc taaggagaca      1440
     ccttgtgcga ttgttgagcg ggcatcatgc ccagaccagc gtgtcattcg ctcgaccttg      1500
     gaacacgttt gcttggcctt tgaagaagca ggttcgcgac caccgggatt gctggtcgtg      1560
     ggtgccagtt gccatgtgct gcacaatccc caaggccagc gatgggtgat tgaggagggt      1620
     ttccatggac tggatgaact ccgtagtgaa gtggatgtgg tcgctgtgtc catggacgag      1680
     aagcagtga                                                              1689
//

If you have problems or comments...

PBIL Back to PBIL home page