(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE317

PENCW_16.PE317       Location/Qualifiers
FT   CDS_pept        join(724533..724588,724619..724727,724847..724931,
FT                   724936..725133,725545..726365)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000241645" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977852"
FT                   /orf_name="Pc20g03170"
FT                   /product="Pc20g03170 protein"
FT                   /function="deoxyribose-phosphate aldolase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /biological_process="deoxyribonucleotide catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85646.1"
FT                   /db_xref="GO:0004139"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009264"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022979"
FT                   /db_xref="UniParc:UPI0001831C88"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP8"
FT                   /transl_table=1
FT                   /translation="MSARPPKPVYFSNGQALQSQTANQRAHSPPLTVRLTRFIESIYFF
FT                   LGLYFTTLFSLDSYAAAENSSFNINNQKNRYTTRSRWGAQPHSVEEAEAEVEVAVVRDL
FT                   VRDALAVWMMSVGRSARAVNKQTVKAVELLLKCNLKEEKSPNGPRCALHQPPSMSEIPA
FT                   TNAEWADKIANMKKQLPRRSLTQPPIPTQIHRTIDHTLLTTPVDASQIDTLCKEALEYD
FT                   FAGVCVRLEHVARAAGHLKGSNTAVACVVGFPEGTHETIEKVREAKEAVQQGATELDMV
FT                   IRYNLLKEGRYKEVFDDVLAVRHAAPTPIVLKAILEATELEEHQLIDATIVSCMAGADY
FT                   IKTSTGWNGGASAQHLKLMNFAAQMCGCTCLIKASGGIRNAEELLRMLKAGANRIGTSS
FT                   GVKIMKEIDEGEVLEQGCGHAVA"
     atgtctgcca gacccccaaa gccagtatat ttctccaacg gacaggctct ccagagtcaa        60
     accgctaatc agcgcgccca tagccccccg ctcaccgtgc gactcacccg cttcatcgaa       120
     agcatttact tcttcctcgg cttgtacttt actaccctct tctcgctcga ctcatacgcc       180
     gccgccgaaa actcctcttt caacatcaac aaccagaaaa acagatatac tacccgctct       240
     cgctggggag cacaacctca ttcggtggag gaggcggagg cggaggtgga ggtggcggtg       300
     gtccgggatt tggtccgcga cgcgttggcc gtgtggatga tgtccgtggg ccggagtgca       360
     agagctgtca ataagcagac agtgaaagcg gttgaattgc tgctaaaatg taacctcaag       420
     gaggaaaaat cgcctaatgg accaagatgc gcactacacc aaccgcccag catgagtgaa       480
     atcccagcaa caaacgccga atgggcggac aagatagcca acatgaagaa gcaactgcct       540
     cgacgctccc tgacccagcc accaatccca acacaaatcc atcgtacaat agaccacacc       600
     ctcctaacga ctccagtcga cgcctcacag atcgacacgc tgtgcaaaga agcccttgaa       660
     tacgacttcg ccggcgtatg cgtgcgactg gagcacgtcg cccgggccgc aggccacctc       720
     aaaggcagca acacagcggt ggcatgcgtg gtcgggttcc cggaaggcac gcacgagaca       780
     atcgagaaag tgcgcgaagc caaagaggcc gttcagcagg gcgccacgga actcgacatg       840
     gtgatccggt acaacctact gaaagagggc cggtacaagg aggtgttcga cgatgttctt       900
     gcggtgcgcc acgcagcgcc gacgccaatt gtcctcaagg cgattctaga ggcgactgag       960
     cttgaggaac atcagctcat cgatgcgacg atcgtgtcgt gtatggctgg cgccgactac      1020
     atcaagacta gtacgggctg gaatggcggt gccagtgctc agcatcttaa gcttatgaac      1080
     tttgcggcgc agatgtgtgg gtgcacttgc ttgatcaagg ctagtggtgg tattcgcaat      1140
     gcggaggagc tgttgcgtat gcttaaggct ggagccaatc gcattggaac tagttctggg      1200
     gttaagatta tgaaagagat cgatgagggc gaggttctcg aacagggatg cggccatgca      1260
     gttgcttga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page