(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE318

PENCW_16.PE318       Location/Qualifiers
FT   CDS_pept        join(complement(728624..728968),complement(727198..728562))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194233" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948862"
FT                   /orf_name="Pc20g03180"
FT                   /product="Pc20g03180 protein"
FT                   /protein_id="CAP85647.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001831C89"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFP9"
FT                   /transl_table=1
FT                   /translation="MLSESFVASTLSSAKSPTASLRDVGVCIHELQPSSILRSTFKKSS
FT                   TLTNCLAVSPSHIFTAQADKAVLHVYNREKGNQEGVVPFPERIRSIAVAGGKYGDVLVL
FT                   GTEGGRLIVWETCTGRQVATTASHLQPVTSLVVDPTSNFILSGSADASVHVWSLPGILS
FT                   FSKPALSATRQPTNSPIRTFSNHRAAITSLAVGHSNGRHNIVVSTAKDNTAIAWDYHTG
FT                   RALRTFLLPLSATSVALDPVDRAFYVGYEDGSVQSVDFYRSQSAQHPLHDPSVQSTPAQ
FT                   VSMEDRWLPPSAETGSAKAISLTYDGTTLLSGHANGKVLSWNVARRKYTSSVADYTHPI
FT                   TNLVMLPPGGIPHPSSDLKRKAHTIVKPRHDSGLSAPNHAPGAVPAEYMFHTQIIAPSD
FT                   SRKPTEFSQALTHSSFPTSMIEDGLAELAAFRQPGSAEVTRVASNAVPARETLEDTAAR
FT                   DSQVTELENEVAVLKKKVAVNETARHNADDEVVQLRSDLANLQDYINELHEKQEAAQQE
FT                   KVLRQARKQEHETKKREAWLAAEKKGRNGDAVIQKMDIDGDVTSDSDDPSDE"
     atgctttccg aatcatttgt ggcgtcgacg ctgtcatccg ccaaatctcc gacagcctcc        60
     ctcagagatg ttggggtctg catccacgaa ttgcagccct cgtccatact gcgatcgact       120
     ttcaagaaga gctcaacttt gacgaattgt ctggctgtca gcccctcaca tattttcaca       180
     gcccaagcag acaaggctgt ccttcacgtg tacaaccggg agaagggtaa ccaagagggc       240
     gttgttccat ttccggagcg gatacgcagc attgctgtcg cggggggcaa gtatggtgat       300
     gtcttggttt tgggcaccga gggtggtcga ttaattgttt gggagacatg cacaggacgc       360
     caagtagcca caacggcctc ccatttgcaa ccggtgactt cactcgtcgt cgaccccacg       420
     tccaatttta tcctgtcagg ctccgctgat gccagtgtac atgtctggtc cttgcctggc       480
     attctctcgt tctcgaaacc cgctcttagc gcgactcgcc aacccacgaa ttcacctatc       540
     cgaactttct ccaaccaccg cgcagctatc acctctcttg ctgttgggca tagcaatggc       600
     cgccataaca ttgtcgtatc aaccgcaaag gacaatactg cgatcgcatg ggactatcat       660
     accggtcgtg ctctaagaac cttccttctt cccttatccg caacatctgt ggctctagac       720
     cccgtcgacc gggctttcta cgtcggatat gaagatggca gtgtgcaatc agtagacttc       780
     taccggagtc agtctgcgca gcatcctctt cacgatcctt cagtacaatc aacacccgca       840
     caagtgtcca tggaggaccg gtggctccct ccctcggctg aaacaggctc agcgaaggca       900
     atctccctta catatgatgg taccacgttg ctctccggcc acgcgaatgg taaggtgctg       960
     tcttggaatg tcgcgcggcg aaagtacaca tcatcagttg ccgactatac gcacccgatc      1020
     accaacttgg taatgctccc tccgggaggc atccctcacc cttcctcaga tttgaagaga      1080
     aaagcccata caattgtcaa gccgcgccat gatagcggcc tttccgcccc gaaccatgcc      1140
     cctggcgccg ttcccgcaga atacatgttc cacacgcaga tcattgcgcc atccgactcc      1200
     cgcaaaccaa cagaattctc tcaggcgctt acccactcct cttttcccac ctccatgatc      1260
     gaagatggtc ttgcagagct cgcggcattc cgccagcctg gtagtgcgga agttacccgc      1320
     gttgcttcaa acgctgtgcc cgccagagaa accctagagg acacagctgc ccgcgattcg      1380
     caggtcaccg agctagaaaa tgaggtggct gtgctcaaga agaaggttgc ggtgaacgag      1440
     actgctcgcc ataatgcaga cgatgaggtt gtacagctgc gctcggacct tgccaatctg      1500
     caggattaca tcaatgagtt gcatgagaag caggaggccg cacagcagga gaaggtcctg      1560
     cggcaagcaa ggaagcagga acacgagacg aagaaacggg aagcttggct cgctgcagag      1620
     aagaagggtc gcaatggtga tgcagtcatt caaaagatgg acattgatgg tgatgttacc      1680
     agtgactcgg atgatcccag tgatgaataa                                       1710
//

If you have problems or comments...

PBIL Back to PBIL home page