(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE319

PENCW_16.PE319       Location/Qualifiers
FT   CDS_pept        join(730217..731329,731389..732381)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217213" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824634"
FT                   /orf_name="Pc20g03190"
FT                   /product="Pc20g03190 protein"
FT                   /protein_id="CAP85648.1"
FT                   /db_xref="UniParc:UPI0001831C8A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ0"
FT                   /transl_table=1
FT                   /translation="MDSGATDIPSHACFPAQIQTHIRNQGSNSSSMSHDVMAMAEPIPS
FT                   PRRWSPTYVPRRRSRQMPSLSFVPSPVMPRIESHDFSTSASRRTTDRGPACMSPFRSVR
FT                   RMKEPFQLMLPTSPASLEGPPPNFPEKTRRPSKAPADHTLRTWRSDQNLTCGSLEAFGL
FT                   LPSPPISESRPASTGPELSYFDSQSSDESVRSSDGKDEKDEPGTQPEVSTKAATLEIGE
FT                   KIQYTAYRPPDWKNQPRTDVMNVHEAHSEFVRQCESGNAQQSNPQSPKKAAPSQASPKP
FT                   ESSETVLIPGSSPRPQRPRTATVSSEASWVPSNFSYCERWLQGVPVDKVDDQKTSTKEF
FT                   TNRRKFQIVENDPPMPKLDIIPGAKALEEPVRFVVASKTKPKLVDIARQSSPSPPLLPP
FT                   PCLQPNTVPTTPDQRQEEVSAFSPDTPLDMSDSGYGTRDSGYSFDSFEGSKVDDDDDAY
FT                   TDPGSLTSSDSVGSTVICEKPESTQGEREISPQPEIRSGSVSPKASSPPTTHAPGRKSP
FT                   MSEQEDEKPRILHHDWTLDDHEWTLDELDHSVKDFPRHMLRLASPVMVFLRKNDEKALI
FT                   KPFRTIFPDVAENLLDGLCAALLARNYLLSLSTTCRTKPTTSPRKDAYTIDGVPKKAYN
FT                   TLGIQLPPGSASKPKDPLFSSRSADLQTQLERIVDNLLFAICGRSDPTLKSAVEVLAQV
FT                   LETNASH"
     atggactccg gtgcaacaga catacctagc catgcatgtt ttccggccca gattcaaaca        60
     catataagaa accagggctc aaactcgtcg tcgatgagcc acgatgtgat ggcaatggcc       120
     gagcctattc catcaccgcg ccgatggtct cccacctatg taccccgaag gcgaagtaga       180
     cagatgccgt cactatcatt tgtaccgtca ccagtgatgc cgcgcataga gtcgcatgac       240
     ttttcgacct cagcatcacg gcgcaccaca gatcggggtc cagcttgcat gtcacccttc       300
     cgctcggttc gaaggatgaa agaaccattt caattaatgc ttccgacatc cccggcgtcc       360
     ctggaaggcc ctccccccaa ctttcctgaa aagacaagga ggccgtcaaa agcaccggcg       420
     gaccacacac tacgaacatg gcgctcagac caaaacctga cttgcggcag tttggaggca       480
     ttcggccttc tacccagccc gcctatatca gaatcacgcc ccgcaagcac gggtcctgag       540
     ttatcttact ttgattcaca gtcctccgat gaatctgttc gatcaagtga cgggaaggat       600
     gagaaggatg agcctggtac tcagccggaa gtttctacca aggcagcaac acttgaaatt       660
     ggggaaaaga tacaatacac agcgtaccgc cccccagact ggaagaatca accgcgaaca       720
     gatgtcatga atgttcatga agcccactca gagttcgtac gtcagtgtga gtctggcaat       780
     gcacaacagt caaaccccca atctccgaag aaggctgcac cttctcaagc atctccgaag       840
     ccagagagta gtgagacagt ccttattcct gggagctcac ctagacccca acgtcctcgg       900
     actgcgacag tctcgagtga agctagctgg gttcctagca acttctcata ctgtgaaaga       960
     tggctgcaag gggtcccggt tgacaaggtg gacgaccaaa aaacatctac aaaagagttc      1020
     accaatcggc ggaagttcca gattgttgag aacgatcctc caatgccaaa actggacatc      1080
     atcccggggg caaaggccct cgaagaacct gtgagattcg tcgtcgctag caaaacaaaa      1140
     ccgaaacttg tcgatatcgc tcgacaatca tcaccatcgc ctccactgct tccaccgcca      1200
     tgcttacagc caaacaccgt accgacaacg ccggatcagc gtcaagagga agtatccgca      1260
     tttagcccgg acactccgct tgatatgtct gatagtggtt acggaactcg cgattccggc      1320
     tattcctttg acagctttga gggtagcaaa gtcgatgacg acgacgatgc ctatactgat      1380
     ccaggatcat tgacctcttc ggacagtgtc ggatcaaccg tcatctgcga gaagcctgaa      1440
     tccacgcagg gagagcgcga gataagccca caacctgaaa tcagatcggg cagcgtgagt      1500
     ccaaaggcat catccccacc aacaactcac gcaccagggc gaaagtctcc catgtcggaa      1560
     caggaagatg aaaagccacg aatattgcac catgactgga cgctggacga tcatgaatgg      1620
     actctagatg agctcgacca ctctgtcaaa gattttcctc gccatatgct ccgcctcgca      1680
     tcccctgtca tggtattcct tcgcaagaac gacgagaagg ccctcattaa gcccttccgc      1740
     actatattcc ccgatgtcgc ggagaacctc ctcgacggtc tctgtgctgc cctcctcgct      1800
     cgaaactacc tcctttctct atcaaccacc tgccgaacta agccgaccac ctctccgcgc      1860
     aaagacgcct acaccatcga cggtgtcccc aaaaaagcat acaatacact ggggatccag      1920
     cttccacccg gttctgccag caagcccaag gacccccttt tcagctctcg cagcgcggat      1980
     ctccagacac aactcgagcg aattgtggat aacctcctgt tcgccatctg cggccgatca      2040
     gatcctactt tgaaatctgc tgttgaagtt ctcgcccaag tgctcgaaac caatgcttcg      2100
     cattga                                                                 2106
//

If you have problems or comments...

PBIL Back to PBIL home page