(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE32

PENCW_16.PE32        Location/Qualifiers
FT   CDS_pept        76813..78951
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187542" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946682"
FT                   /orf_name="Pc20g00320"
FT                   /product="Pc20g00320 protein"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAP85361.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="InterPro:IPR007151"
FT                   /db_xref="InterPro:IPR012173"
FT                   /db_xref="UniParc:UPI00018319D8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF43"
FT                   /transl_table=1
FT                   /translation="MAKGQSKSKTVSASTAQASEQMPLSFALSSPWSFLRPTNDLHTNV
FT                   VDSAKHILDSLAGSVVDAQTARRQLNKKRKRSDLESDSVTQLQLKNLYVDGFTSNQIWE
FT                   QATRILQSTGDEIERDITLITQHGGYMESADSGQLEDISDPEGAQSDSDSQESMLEDLS
FT                   EGSGAEDDLDEGSDEEVDMGSDDDMEDIEDMDEDNSSVGSAEEEPEVFVEDKFGLNDGF
FT                   FSIDDFNKQSEALERQDAAGGPEQEDSDEEDLDWHSNPLIAGNAATIHDDDKSKNSRPT
FT                   EKEDESMDDSEEEGPTFGNADLNGDSDSDDEDAADMEDGEAAAWVNTSDIKYADFFAPP
FT                   PRKVSNKKHRALPKTQPDAPAIDESDVKRAMDDVRRDLFDDMDADSAEEEDENLDGSTD
FT                   PTAQRSTHEKQRARIADEIRRLEAANVAKKEWMYTGEARAVERPVNSLIEEDLEFERIG
FT                   KPVPVNTNETTEDIEELVKRRILAMEFDEVIRRRPGAEGQQAGRKPRFELDDTKPQQGL
FT                   AEMYETEHLRANDPNFVDTKDRKLMREHAEITSLWNELSSQLDTLCNWHYKPKVAQASI
FT                   NVVTDAPTIMMEEARPTAGGAAGGPVGLAPQEIYAPGDDGRVKGEVVLKTGASISKEEM
FT                   SREQKAKNRRQNKQTQKKADAAKPTQQKPGKAAEKQQMISDLKKGGVKVIDKEGRMTNI
FT                   DGGSVQEGAKNRGDNLKL"
     atggcgaaag ggcagtccaa atccaagact gtatcggcta gtaccgccca agcatccgaa        60
     cagatgcctc tctcgttcgc tctgtcctcg ccatggagtt tcctccgtcc cacgaacgat       120
     ttacatacca acgtcgtgga ttctgcgaag cacatcctgg actccctcgc tggttccgtc       180
     gtggacgccc agaccgctcg ccggcaactc aataaaaagc gcaaaaggtc agacctcgaa       240
     tcggattcag tcacccagct ccaattgaag aacctctacg tggacggttt cacctcgaat       300
     caaatatggg agcaagcaac acggattctc caatcgactg gcgatgagat tgagcgcgac       360
     atcactttga ttacccaaca tggcggctac atggagtcag ccgactccgg gcagctcgag       420
     gatatctctg accccgaggg tgcgcaaagt gacagcgaca gccaggagag catgcttgaa       480
     gatctctccg agggttcagg cgctgaagat gatctcgacg aagggtctga cgaagaggtt       540
     gatatgggat ctgacgacga catggaagac attgaagaca tggacgagga taattcgtca       600
     gttggttccg ccgaagaaga acccgaagta ttcgtggagg ataaatttgg attgaacgac       660
     ggattcttct cgattgacga cttcaacaag cagtccgagg ctttggagag acaggatgct       720
     gcagggggac ccgagcagga agacagcgac gaggaggatc tcgactggca ttccaacccg       780
     ttgatcgctg ggaatgctgc gaccattcac gatgacgata aatccaagaa ttcacgtcca       840
     acagaaaagg aagacgaaag catggatgat agtgaggagg aagggccgac tttcggtaat       900
     gccgatctca acggtgactc cgactctgac gatgaagacg ccgcggacat ggaagacggt       960
     gaagccgctg cctgggtaaa caccagcgat atcaaatacg ccgatttctt cgctcctcca      1020
     ccccgcaaag tctccaacaa gaaacaccgc gccctcccga aaacccaacc tgatgcaccg      1080
     gcaatcgatg agagcgatgt caaacgcgct atggatgacg ttcgacggga cttgtttgat      1140
     gatatggatg cggactccgc cgaagaagag gatgagaatc ttgacggatc tacagatcct      1200
     actgcccaac gctcaacaca tgagaagcag agggcacgga tcgcagatga aattcgtcgt      1260
     ctagaggcgg ccaacgtggc caagaaagaa tggatgtata ctggtgaggc cagagctgtc      1320
     gagcgacccg tcaattctct catcgaagaa gaccttgaat ttgagcgaat tggaaagcct      1380
     gttcctgtca acacaaatga gaccaccgag gacatcgaag aactggtcaa gcgccgaatc      1440
     ctcgccatgg agttcgacga agtcatccgc cgtcggccag gcgctgaggg ccagcaagcc      1500
     ggaagaaaac cccgcttcga gctggatgat accaagccgc aacaaggtct tgccgagatg      1560
     tatgaaaccg aacatcttcg cgctaatgat cccaacttcg tggatactaa ggaccgcaag      1620
     ttgatgcggg aacatgccga gatcaccagt ctttggaacg agctcagctc tcaactggat      1680
     acgctatgca actggcacta caagcccaag gtggcccaag ccagcatcaa cgtcgttacc      1740
     gatgcgccaa caatcatgat ggaggaggca cgcccaacgg ctggcggcgc tgccggtggc      1800
     cctgttggac ttgcaccgca ggagatctac gcgcccggtg atgatggccg agtcaaggga      1860
     gaggtggtcc tcaagactgg cgcgtcgatc tccaaggagg agatgagccg tgagcagaag      1920
     gccaagaaca gacgccagaa taagcaaact cagaagaagg ccgatgctgc caaacctact      1980
     cagcaaaagc ctggcaaggc agccgagaag cagcagatga tttcagatct gaagaaggga      2040
     ggagtcaagg tcattgataa ggagggccgt atgacgaata tcgacggcgg ctctgtccaa      2100
     gagggtgcca aaaacagagg agacaatctg aaattgtga                             2139
//

If you have problems or comments...

PBIL Back to PBIL home page