(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE323

PENCW_16.PE323       Location/Qualifiers
FT   CDS_pept        join(739240..739863,739916..742921)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948864"
FT                   /orf_name="Pc20g03230"
FT                   /product="Pc20g03230 protein"
FT                   /protein_id="CAP85652.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001831D5C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ4"
FT                   /transl_table=1
FT                   /translation="MKWLPRFRPRKASSGDPKGNSAVAPSPPVGPEMIAPSTNSIPASS
FT                   LSEQATSPSVVDSSPFPTAVCAAQLQAGQAAASISPSAGSPPAPSTSAVQDIDIWTTAY
FT                   EVVENREPELMTDYASHLASIQGNPTTKNHISSSEFVEDVVTQLLEEREKKQWRLPLLG
FT                   NNVIVRKQAERLAKVLLWADPVVKRAVSTQPYAALAWSSVSILLPLLTGAATPDVAMLK
FT                   GFNSISDVQVYWAIFEETYLSSSHRQHYENLIEPLAKLYSYIIEYQARAICHLSKTQLS
FT                   RGWQNVAGEDDWAEKASEIEALSEARSSLISHDNETEIRERWGRQLREIQESSAILKEI
FT                   RQVLDETQRQTQGNYEDKAEKDLLHDLASDYEGYKDFNRLRVQGTCEWFFNDEKFCKWR
FT                   DSNTSGLLWLSAGPGCGKSILSRALIDERRLSLNVTTSTVCHFFFKDGYEDRMYSVNAL
FT                   CAVLHQLFSHDPSGALIKLALPAHKNYGKSLVRNFSELWNILLDCAKSPHAGEIVCIFD
FT                   ALDECEQQSRLQLISKLKDFYCQPQGSSALSSKLSFLITSRPYAEIERNFSGFSTTEYL
FT                   HFDGDKKSVAITREIDLVIDDHVSQIIGNFTANDQLEISKRLKTMENRTYLWLYVIFET
FT                   IKEDPSRHGKRSSVEKLLNNIPSKLSEAYEKILGRSRCQEETQHLLEIILAAARPLTLD
FT                   EANVALTLALAEEDFTSHSALENDLWPKNNFESIVKGLSGLFISVHDSKLFFIHQTARE
FT                   FLIDPSGRGTWEGRLSMSKSSRTISRTCFKFLMLPDLRASVKDADFWDDDDYDLNDPNH
FT                   VTLEQLPPFFCYAADHWPSHFLSQGATDIDQSLKDARTLCNRHQAWVWVTASGWTPGGR
FT                   LTLFHHMTDLSLASYFGLKQVVENILTEEHIDVNTEDESSTLALRSSRSALSAACLGGK
FT                   SDVVTLLLDKGANVNSYHKLHATALYTALVYGHQDIVPILLEKGADVNITGEHHGTALY
FT                   MASHLGNPDIVLSILERGADINYNHKWHGTALYRACRSGHPKVVKILLENGANVNIGDR
FT                   GYGSALLAASTHNCPDIVIDLLKKDADTDYNNQKYGTALRMASGHGWQNVVEVLLAHGA
FT                   DPNIRGTEYGSSPIQVASFFGHQGAVEELLKHGADVNFPDQQGNTALLAAARQGHREIV
FT                   SMLLRCGADVTVKGERYGTALNAATEAGHTEIIEMLAKRGAKV"
     atgaagtggc ttccgagatt cagaccccga aaggcaagta gcggtgatcc caaggggaac        60
     agcgcggtcg ctccttctcc gcctgtaggg ccagagatga tcgcgccttc tacaaattca       120
     atacctgcct ccagtctctc agaacaagct acaagccctt ccgtggtgga ttctagtcct       180
     ttcccgaccg ctgtgtgtgc cgcacagtta caagctgggc aagctgcagc atctatctcg       240
     ccctctgcag gttcaccgcc cgctccgtcc acaagtgcag tccaggacat cgacatatgg       300
     actactgcct acgaagtagt tgagaatcga gagccagagt tgatgacaga ttacgcgagc       360
     catctggcct ctatacaagg taaccccacc accaaaaatc atatttcaag ctcggagttt       420
     gtcgaagatg tcgtgacgca gctgctggaa gaacgagaga agaagcaatg gcggcttcct       480
     ctcctgggta ataatgtcat tgtccgaaag caagccgaga gactagcgaa agttctctta       540
     tgggctgatc ctgttgtcaa acgtgccgtg agcactcaac catatgcggc gcttgcctgg       600
     tccagtgttt ccatccttct tcctctactg acaggtgctg ccacaccgga tgtagctatg       660
     ctgaagggtt tcaactcgat cagcgatgtt caagtctatt gggcaatttt tgaagagact       720
     tatctgtctt cttcccaccg acaacactac gaaaacctca tcgagccttt ggccaagctc       780
     tattcttaca tcattgaata tcaagcccgc gctatatgcc atctttcaaa gacccagctt       840
     tcacggggat ggcagaacgt ggcgggtgag gatgactggg ctgagaaggc gagtgagatt       900
     gaagctttat cagaggctcg cagcagcctg atctcgcacg acaacgagac ggagattcga       960
     gagcgctggg gtcgtcaact acgtgaaatt caagagtcaa gtgctattct caaggagatc      1020
     cgccaagtcc tcgatgaaac ccaaagacaa actcagggga actacgaaga caaggcggaa      1080
     aaagatctcc tacacgatct agcttctgat tatgaaggct acaaagattt caaccgtctc      1140
     agagttcaag gcacgtgcga atggttcttc aacgatgaaa agttctgcaa atggcgcgat      1200
     agcaacacgt ctgggctttt gtggctctct gctggacctg gatgtggaaa atcgattttg      1260
     tcgcgagcgc ttattgacga acgacgacta tccttgaacg ttacaacctc gaccgtttgt      1320
     cacttcttct ttaaagatgg ctacgaagac cgcatgtata gcgtcaatgc tctatgtgca      1380
     gtactccacc agctttttag tcacgaccct agcggtgcct tgatcaagct agctctgcct      1440
     gctcacaaga attacggcaa atctcttgta aggaacttct ctgaactatg gaatatcctt      1500
     ctcgattgcg ccaagagccc tcacgctgga gaaattgtct gcattttcga tgctctggat      1560
     gaatgcgagc aacaaagcag gttgcaattg atcagcaaac tcaaagattt ctattgccag      1620
     ccacagggct cttcggcgtt atcttcgaaa ctgagcttcc ttataaccag tcgaccgtac      1680
     gctgagatag aaagaaactt tagtgggttc tccacgacag agtatctgca ttttgacggc      1740
     gataagaagt ctgtcgccat cacgcgggag atcgacctgg taattgacga tcatgtgagc      1800
     cagatcatag gcaacttcac cgctaatgat cagctggaaa tctctaaacg cctcaaaacc      1860
     atggaaaacc gcacctactt atggctttat gtcatcttcg aaacgatcaa agaggacccg      1920
     agccgccacg ggaagcggtc cagcgtcgaa aaattgttga acaatatccc atcgaagtta      1980
     tccgaagcgt atgaaaaaat cctgggcaga agcagatgcc aagaagaaac tcaacatctt      2040
     cttgagatca tccttgctgc ggcacggcct cttactcttg acgaggctaa cgttgccttg      2100
     acattggctt tggcagaaga agatttcacg tcacactcag ccttggagaa tgatctatgg      2160
     cctaaaaaca atttcgaaag cattgtcaaa ggattaagtg gcctcttcat cagtgtacac      2220
     gattcaaagc tgtttttcat tcatcaaacg gcaagagagt tcctcattga cccttcaggc      2280
     cggggtacat gggaaggacg cttgagcatg tccaaatcat ccagaaccat atcaagaact      2340
     tgtttcaagt tcttgatgct ccctgatctt cgcgcctccg ttaaagacgc tgacttttgg      2400
     gatgacgatg attatgacct aaatgacccg aaccacgtta ctttggagca actgcctccg      2460
     tttttctgct acgccgccga tcattggccg tctcattttc tatcacaggg ggccacagac      2520
     attgaccagt ccctaaagga tgcgcgtaca ctttgtaacc gccatcaggc atgggtgtgg      2580
     gtaacagcct ctggatggac tcctggaggt aggctcacgc tctttcatca catgaccgat      2640
     ttgtctttgg caagttactt tggattgaag caggtggtcg agaatatctt gacagaggaa      2700
     cacattgatg tcaacacaga agacgagtct tcaacactcg cactgcgatc ttcaagatcg      2760
     gcgctttcag cggcatgcct cggaggcaag tcagatgttg tcacgctact attggacaaa      2820
     ggtgccaatg tcaactccta tcacaaactg cacgccacgg ctctctatac agctctggtc      2880
     tacggtcacc aagacattgt tccaatcctc ctcgaaaagg gcgccgacgt caacatcaca      2940
     ggcgaacatc acggtacagc gctttacatg gcctcgcatc tcggcaaccc agatattgtc      3000
     ctcagcatcc tggagagagg cgcagacatc aactataatc acaaatggca cggaacagcg      3060
     ctgtacaggg catgtcgctc aggccacccg aaagtcgtca aaatcctact cgagaacggg      3120
     gccaacgtca acatcggaga tagaggatat ggctcggcgc tcctcgcagc atctactcac      3180
     aactgtccag atattgtcat tgatctgcta aagaaagatg ctgacaccga ctataataac      3240
     caaaaatacg gcactgcact acggatggca tctggacatg gctggcaaaa tgttgtcgaa      3300
     gtactcctag cgcatggagc cgatccgaac atcagaggca cagaatatgg tagctcacca      3360
     atccaggtgg catcattctt tggtcatcaa ggtgctgtcg aagaattact caagcacgga      3420
     gctgatgtca atttcccaga tcagcaggga aacacagcgc ttctcgcggc tgcgcgacaa      3480
     ggtcatcgag aaattgtttc aatgctcctc agatgtgggg ccgacgtcac cgtgaaaggg      3540
     gaacgttatg gcacggcgct caatgcggca actgaagcag gtcacacaga gattatagaa      3600
     atgctagcta agagaggtgc caaggtttga                                       3630
//

If you have problems or comments...

PBIL Back to PBIL home page