(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE328

PENCW_16.PE328       Location/Qualifiers
FT   CDS_pept        join(750664..750853,750927..751084,751148..751241,
FT                   751295..751523,751577..753951,753995..754086)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195648" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948866"
FT                   /orf_name="Pc20g03280"
FT                   /product="Pc20g03280 protein"
FT                   /protein_id="CAP85657.1"
FT                   /db_xref="InterPro:IPR012965"
FT                   /db_xref="UniParc:UPI0001831D61"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ9"
FT                   /transl_table=1
FT                   /translation="MSFFSRVFRGKDSTATKKQVKPTAPVNTAPAKPKWTDAWQRTEVA
FT                   PEEVQDLVRGCVHELKARALDTPFLLLPFRPSSDPSAARTFIRNYFNQSFEKGSPVNGD
FT                   ALSQELRLTEPMVVCGVMKWCWSRLPGGVVTWEAYETFKMGEHDSDMARDAFSTFIPIG
FT                   GDSEARTNIILDFFDLLAAIAAHGKSNGLGGRKLSRYAGWWAFEHVDTGNGFEAAYKNW
FT                   AAAADATSHLFFAYLRSLSPDVPGGVSGISSLPISLQSLVEATEYPPETPTLLQMTTTK
FT                   VVMIVENVSPTPFSLLRRAKNFEYRDDDWHLQEFANYEDPVSALTDECLRVLTCISSTN
FT                   QSSVSSTKQSTSLRDASWSRFEDIGFGGSIESDPEDEAKETAPPVTAKSGSAAGLKSVP
FT                   QSGTGDLGRPTTPSWADFMSSGFADENNLKQHVGPLLLPPDKVLPPIASARGMSSQSHK
FT                   RSLDIEPALEPAELASINTLDMDDSFWWVWISSLSGDEPSARKAVFGRCALLETRIRDT
FT                   KWLILEEQVKGAAPEPEAGAQIVEKKRFFSFGSRKGKLGRRKSSAKKVPSSIEDSYKRP
FT                   NNLGTQSKTSIGPDQHKRIQEAAAALQRKHREQEAEAKENRAAPNNSRYSKTNSVMTLQ
FT                   PAIVNEASQAMKWTKNYDKGAFRAAYLSDNRAGTGHIEEPEETPEPISKDPEEKPTAPL
FT                   APLPTNTAKSAPPPLPKEAAAAVSTPLPPFPKEVPTKPVNVATPEEEKPITKPAVVEQP
FT                   TERRESMDEMGKKLKKKTGNSAFKSMFSAKKKPEQQQPPVKNGDSKEISNVAATRAALE
FT                   AKAKAAQESGPVKKKPLPTAAAVAVTPVATEPEKPSSPQPVQPTINEPVTNPTSPTPPS
FT                   ASLKENGENGAPPKTRRAVEYDALSRVGTNERDAADQEFSKFDQGPLTDQPAFVPADSP
FT                   VEVTPAAQKPELPQTPTNGNGVRPVSATSPESTEATQDRWKAIREAAAQRTAAAQAEKA
FT                   HEHDTEANTRTSQSERTDEGDTSGEEIAFPAIEARVARIKARVAELTGNAEDGPRR"
     atgtccttct tctctcgcgt ctttcggggc aaggactcca ctgcgacaaa gaagcaggtc        60
     aagcctaccg cgcccgtcaa cacggcccct gcgaaaccca aatggaccga tgcgtggcag       120
     cggacagaag ttgcgccgga agaagtccaa gaccttgtac gagggtgtgt gcatgagctc       180
     aaggcccgag ctctcgacac gccattcctc ctcctaccgt tccgtcctag ctccgacccc       240
     agcgcagccc gcacgttcat tcgcaattac tttaatcagt cttttgaaaa gggctcgccc       300
     gttaacggag atgccttgtc gcaggaactc aggctcactg agccgatggt tgtctgtggt       360
     gtgatgaaat ggtgctggag cagacttcct ggcggtgttg tcacttggga ggcgtatgag       420
     accttcaaga tgggcgaaca tgattcggat atggcccgcg acgctttctc gactttcatt       480
     ccgatcggcg gcgattccga ggcacgcacc aatattattc tagacttctt cgatcttttg       540
     gctgccattg cggcccatgg aaaatccaat ggcttgggcg gccgcaaact ttcccgatac       600
     gctggatggt gggcatttga gcatgtcgat acaggcaatg gcttcgaggc cgcctataag       660
     aactgggctg ctgctgccga tgctaccagc catttgttct tcgcttacct tcgttcgttg       720
     tctcccgatg tccctggcgg cgtgagcggc atctcatcgc tgccaatttc tctccaatca       780
     ctcgttgaag cgaccgaata ccctcctgag accccgactt tattgcaaat gacaactaca       840
     aaggttgtca tgattgtgga gaatgtttcc ccgacaccct tttccttgtt gcgacgcgct       900
     aagaactttg aataccgtga cgacgactgg catctgcagg aatttgccaa ctacgaagac       960
     cccgttagcg cattgaccga cgagtgcctc cgcgttctca catgtatctc gtctacgaac      1020
     caatccagcg tctcgagtac caagcaatcc accagtttac gggatgcgtc ttggtctcgt      1080
     ttcgaggata ttgggttcgg tggttcgatt gaatctgatc cggaggatga agccaaggaa      1140
     actgctccgc cggtgactgc aaagagtgga tctgcggcgg gcttgaaatc cgttcctcag      1200
     tctggaacag gcgaccttgg ccgtcccacc accccctcgt gggcagactt catgtcatcc      1260
     ggattcgcgg atgaaaataa cttgaagcag catgtgggcc ctctgctctt gcctcctgac      1320
     aaggttctgc ctcccattgc ctctgcacgt ggcatgagct ctcagtcgca caagcgctct      1380
     ttggacatcg agccggctct cgagcctgcc gagttggcga gtatcaacac cctagacatg      1440
     gatgactcgt tttggtgggt ctggatcagc agtttatctg gcgatgagcc gtccgcccgc      1500
     aaggctgtgt ttggtcgatg cgcgctcctg gagactagaa tccgggatac caaatggctg      1560
     atcctcgaag agcaggtcaa gggtgctgcc ccagagcctg aggccggcgc tcagattgtc      1620
     gagaagaagc gattcttcag cttcggtagc cgtaagggga agctcggtcg ccgcaagtca      1680
     tccgcgaaga aggtgccttc ttccattgaa gactcgtaca agcggcccaa caacctggga      1740
     acgcaaagca agaccagcat cggaccggac caacacaagc ggatacaaga agctgcggcc      1800
     gctctgcaaa gaaagcaccg cgagcaagaa gccgaggcga aagagaaccg tgccgcaccc      1860
     aataatagcc gttactccaa gaccaactcc gtcatgacac tccagcctgc cattgtgaac      1920
     gaggcctccc aggccatgaa gtggactaaa aactacgaca agggtgcctt cagagcggca      1980
     tatctcagtg acaaccgcgc tggcactggt catattgaag aacccgagga gacacccgag      2040
     ccgatctcga aggaccccga ggagaagcct accgcaccgt tggcacctct tccaaccaac      2100
     actgcaaaga gtgctccccc gccacttccc aaagaagctg ctgctgctgt gtccacccct      2160
     ctcccccctt ttcctaaaga agtgccaact aagcctgtca atgtcgcgac tcccgaagag      2220
     gagaagccca tcactaagcc tgccgttgtt gaacaaccca ctgagcgtcg ggagtcaatg      2280
     gacgagatgg gcaagaaact gaagaagaag actggcaatt ctgcctttaa gagcatgttt      2340
     agtgccaaga agaagcccga gcagcaacag cctcccgtga agaacggtga ttccaaggaa      2400
     atatccaatg tggcagctac tcgtgcggcc ctcgaggcca aggcaaaagc agctcaggag      2460
     tccggtcccg tgaagaagaa gcctctcccg accgccgccg ctgtcgcggt tacgcccgtg      2520
     gctactgagc cggaaaagcc ttcatccccc cagcctgttc aaccgaccat caatgaacct      2580
     gtgacaaatc ccacaagccc gactccaccc tcggcctctc tgaaagagaa tggtgagaat      2640
     ggtgcaccgc ccaagactag acgcgccgtc gagtatgatg ctctctcccg cgttggtacc      2700
     aatgaacgtg acgcggccga tcaggagttc tccaagttcg accagggccc actgactgac      2760
     cagcctgctt tcgtccccgc ggattcgcct gtggaagtca cacctgcagc acagaaaccc      2820
     gagcttcccc agaccccgac taacggcaat ggcgtccgcc ctgtttccgc cacttcgccc      2880
     gagtctaccg aagctacaca ggatcgctgg aaggcgattc gtgaggctgc tgcccagcgg      2940
     actgccgctg cccaggcgga aaaggcccat gagcacgata ccgaggctaa cacccggact      3000
     agccagtcag agcgtactga cgagggagat actagtggag aagagattgc tttcccagcc      3060
     atcgaggctc gtgtcgcccg catcaaggcc cgagtggccg agttgaccgg caacgcggag      3120
     gatggaccaa ggcgctag                                                    3138
//

If you have problems or comments...

PBIL Back to PBIL home page