(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE329

PENCW_16.PE329       Location/Qualifiers
FT   CDS_pept        join(complement(755551..755628),complement(755199..755436),
FT                   complement(754698..755089))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948867"
FT                   /orf_name="Pc20g03290"
FT                   /product="Pc20g03290 protein"
FT                   /protein_id="CAP85658.1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="UniParc:UPI0001831D62"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFR0"
FT                   /transl_table=1
FT                   /translation="MTPKVLVVLTSHDKLGSTGNPTGWYLPEFAHPWEVLHEKVSLTIA
FT                   SPKGGEAPLDPASVKMFESDEASQKFLKEQKALWTNTHKLADVLPRAGEFDAIFYVGGH
FT                   GPMFDLTEDPTSLALIQTFAAANKPVAAVCHGPCVLLNATAPSGVPLISGVGVTGFSNA
FT                   EEDAVSLSAAMPFMLETELGRVSGGKYVKAAEPWGEMVVVGKAAGTGSTIITGQNPGSA
FT                   TGVGKEILKALGL"
     atgacaccca aagtcctcgt cgtcctcacc tcccacgaca agctcggctc caccggtaac        60
     ccaaccggct ggtatctgcc cgaattcgcc catccatggg aagtcctcca cgaaaaggtc       120
     tccctaacca tcgcctcacc aaaaggcggc gaagcacccc tagaccccgc atccgtaaag       180
     atgttcgaat cagacgaggc ctcacagaag ttcctgaaag aacaaaaagc cctctggacg       240
     aacacgcaca agctggcaga tgtgctcccg cgcgcaggcg agttcgatgc cattttctac       300
     gttggcggtc atggaccaat gttcgaccta accgaagacc cgacctcact ggctctaatc       360
     cagactttcg cggcagctaa taagcccgtc gcggctgtct gtcatggtcc ttgtgttctg       420
     ctcaatgcga ctgcgccctc tggtgtgccg cttatctctg gcgttggcgt gactgggttc       480
     tcgaatgcgg aggaggatgc tgtgagtctt tctgctgcga tgccgtttat gctcgagacc       540
     gagttgggtc gtgttagtgg tgggaagtat gtcaaggctg ccgagccttg gggggagatg       600
     gttgttgttg ggaaggcggc tgggacgggg tcgacgatta ttacggggca gaatcccggg       660
     tcggcgacgg gagttgggaa ggagattttg aaggctttgg gtctgtag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page