(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE33

PENCW_16.PE33        Location/Qualifiers
FT   CDS_pept        join(complement(79580..79851),complement(79037..79514))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187553" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977334"
FT                   /orf_name="Pc20g00330"
FT                   /product="Pc20g00330 protein"
FT                   /protein_id="CAP85362.1"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI00018319D9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD0"
FT                   /transl_table=1
FT                   /translation="MIETPMTTPPGPELSPPSSPDGLKISESLAPPRELKAATTTDISF
FT                   DGLLKEPLLLKEDLKDGCGGQLWPAGMALAKYLLSRHAADLSDKTIVELGAGGGLVGLA
FT                   VARGCHLEQPIYITDQEPMFSLMKSNIQLNNLGPNATAAILNWGEPIPKQIPSKPNVII
FT                   AADCVYFEPAFPLLITTLQDLLGPNSVCYFCYKRRRRADMRFMKMAKKAFEMELVRDDP
FT                   GAEGYNRESIFIYTIRAKRLDQKSETR"
     atgatagaaa ctccaatgac gactcctccg ggcccagaat tgagcccacc ctcaagtcca        60
     gatggactca agatcagcga atccctggct cctccgcgcg aactcaaggc cgcgacgacc       120
     acggacatct ccttcgacgg actcctgaaa gaaccattgc tactaaaaga agacctcaaa       180
     gacggatgcg gtggccaatt atggccagca gggatggcct tggccaaata cctcctcagt       240
     cgtcacgccg ccgatctatc cgataaaaca atcgtggaac ttggcgctgg aggtggactt       300
     gttggactcg ccgtggcacg cgggtgtcat ctcgaacagc cgatttatat cacagaccaa       360
     gaacctatgt tttccctaat gaagtccaac atccaactaa acaatctcgg cccgaatgcg       420
     actgctgcga tactaaactg gggagaaccg atcccaaagc agattccttc gaaaccaaat       480
     gtcatcatcg ctgctgactg cgtctatttc gagccggctt tccctctctt gatcaccacg       540
     ctccaggacc tcctgggacc caactcggtc tgttacttct gttacaagcg tcgcagacgt       600
     gccgacatgc ggttcatgaa gatggcgaaa aaggctttcg aaatggagct agttcgtgac       660
     gaccctggtg ctgaagggta taacagagag agcatattta tctacacgat acgtgccaaa       720
     cgtcttgacc agaaaagtga gacaagatga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page