(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE330

PENCW_16.PE330       Location/Qualifiers
FT   CDS_pept        join(complement(757060..757493),complement(756311..756458))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948868"
FT                   /orf_name="Pc20g03300"
FT                   /product="Putative uncharacterized protein Pc20g03300 "
FT                   /protein_id="CAP85659.1"
FT                   /db_xref="UniParc:UPI0001831D63"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFR1"
FT                   /transl_table=1
FT                   /translation="MAYNSDVEEYLRLHQLFQLSGEELNYHPGTSATQPPVHSTEWSLY
FT                   NPSISHASESLDPSWSMHTTIGHPTADNLYQSTMQSSSTSQHRGTEDGIQDHFSPDRTT
FT                   IQIQSSRSSPPTQLASPSNYHNVEVADVEATSTRHEPQQQEKKDGSPTSPVPEFPISSR
FT                   VPDSKAVSSMPRYPCRDENALVYMYVQQNG"
     atggcataca attcagacgt tgaagaatat ttgagactac accaactatt tcaacttagc        60
     ggtgaggaac tcaattacca tcccggaact tctgctacgc agccacctgt acactccacg       120
     gagtggtctc tttacaaccc ttctataagc catgcctccg agtctcttga ccccagctgg       180
     tctatgcata ccaccatagg tcaccctaca gcggacaact tgtatcagag caccatgcag       240
     tcttcctcga ccagtcagca cagaggcacc gaggatggaa ttcaagacca tttcagtccc       300
     gatcgaacta caatccagat ccagtcctcg agatcgagcc cccccaccca attggcatct       360
     ccatcaaact atcataacgt cgaagttgct gatgtggaag caacctctac tcgtcacgaa       420
     ccacagcaac aagaaaaaaa agatggtagc cccaccagcc ccgttcccga gttcccgata       480
     tctagccggg tacctgattc caaggctgtc tcatccatgc cgaggtatcc atgccgagat       540
     gaaaacgcac ttgtctacat gtatgtacaa caaaacggtt aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page