(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE331

PENCW_16.PE331       Location/Qualifiers
FT   CDS_pept        join(complement(761217..761223),complement(760890..761134),
FT                   complement(760748..760814),complement(760623..760694),
FT                   complement(760380..760569),complement(760211..760323),
FT                   complement(759272..760158))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195637" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824635"
FT                   /orf_name="Pc20g03310"
FT                   /product="Pc20g03310 protein"
FT                   /protein_id="CAP85660.1"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI0001831D64"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFR2"
FT                   /transl_table=1
FT                   /translation="MTYCTPYLLQLGLTKSKTSLVWIAGPLSGLIIQPLIGVIADRSRS
FT                   KWGRRRPFMVFGSLVVAFCLFVLGWTAEIVGLFVKDPEKAKNGTIALAVLSIYAVDFSI
FT                   NVVQACCRGLIVDTLPIPSQQAGSAWAGRMSAIGQLFAYVVGAIDTVSIFGTFLGDTQF
FT                   KQMTVIAALSLMLAVGVTSYSVKERVLISARDDGSAGAIQVLSQLFKTTFELPPRIQAI
FT                   CWAQFWAWIGWFPFLFYSTTWVGETYFRYEVPKDDMAKATDMLGEVGRVGSLSLTVFSF
FT                   ITVLSSVLLPFCIMQPDAKRTRFTARPPPKVAAILKAISAIRPDLQTAWLISHVMFAAT
FT                   MIFAPLAHSRAFATFLVAVCGIPWAISGWAPFAFMGVEINRLTMGGYYPTIPSSRSGVT
FT                   MITSASLRNSAADTELDVLRLNHHDPTDSDTDEEEQASNIPSTGELAGIYLGVLNVYTT
FT                   LPQFVGTFISWIVFSILEPGEEPANSNSDTQWMNLDKDRYNAISICLFIGAISALVAAE
FT                   ATRRLRYIL"
     atgacttatt gtacacctta ccttcttcaa ctcggtctga cgaagtccaa gacttcgttg        60
     gtgtggattg ctggcccatt gtctggattg attatccagc ctcttattgg agtcattgct       120
     gatcgatcac ggtcgaaatg gggtcggcgt agacctttca tggtctttgg gtcattagtt       180
     gtcgctttct gtctgttcgt cttggggtgg acggcagaga ttgttggttt atttgtcaaa       240
     gatccggaaa aggccaagaa tggcacaatc gccctggctg tgttgagtat ttatgcggtg       300
     gatttctcta tcaacgttgt tcaagcgtgc tgtcgcggtc tgattgtgga tacactaccg       360
     attccatcgc aacaagctgg atccgcatgg gccggaagaa tgtctgccat tggtcaactc       420
     tttgcttatg tggttggtgc catcgatacc gttagcatct ttggtacttt ccttggagat       480
     acgcaattca agcagatgac tgtgatcgct gctttgtcat tgatgttggc agtgggagtc       540
     acatcatact cggtaaaaga gcgagtgctt atatctgcaa gggatgacgg aagtgctggt       600
     gctattcaag tcctctctca gctgttcaaa actactttcg aactaccccc tcgcatccaa       660
     gccatttgct gggcccaatt ttgggcttgg attggctggt tccccttcct cttctacagc       720
     acaacctggg ttggcgaaac ctacttccgt tacgaagtac caaaagacga catggccaaa       780
     gcaacggata tgcttggtga agtcggccgc gtgggcagtc tttcattaac ggtcttctcg       840
     tttatcacag ttctcagctc tgtactccta cccttttgta tcatgcagcc agatgccaag       900
     aggacgcgtt tcaccgcacg accaccaccg aaagttgcag cgatccttaa agccatcagc       960
     gcaattcgac ccgacctcca aaccgcctgg ctaatctccc acgtcatgtt tgccgcgaca      1020
     atgatcttcg ccccgctagc acactcccgc gccttcgcaa ccttcctagt agcagtatgc      1080
     ggtattccct gggcaatcag cggctgggct ccattcgcct tcatgggcgt ggaaatcaac      1140
     agactaacaa tgggcggcta ttaccccaca ataccgtcct cgcgttccgg cgtgacaatg      1200
     atcacctcag ccagtttgcg caactccgca gcagacaccg agctggatgt tctccgactc      1260
     aaccaccacg atcccaccga cagcgacacc gacgaggagg aacaggcgtc caatatcccg      1320
     tcaacaggtg aactagccgg catctacctg ggcgtgctga atgtgtacac gaccctgcca      1380
     caattcgtcg gcaccttcat cagctggatt gtcttcagta tcctcgagcc gggcgaagag      1440
     cccgcaaaca gcaattcaga tacgcagtgg atgaacctcg acaaggatag gtataacgcc      1500
     atctctatct gtctcttcat cggggcgata agtgctctcg tggcggctga ggctacccgg      1560
     agactgcggt atatactatg a                                                1581
//

If you have problems or comments...

PBIL Back to PBIL home page