(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE332

PENCW_16.PE332       Location/Qualifiers
FT   CDS_pept        join(761455..761601,761656..761952)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977855"
FT                   /orf_name="Pc20g03320"
FT                   /product="Putative uncharacterized protein Pc20g03320 "
FT                   /protein_id="CAP85661.1"
FT                   /db_xref="UniParc:UPI0001831D65"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG20"
FT                   /transl_table=1
FT                   /translation="MEGVPAHLAACGILIIHVLACTQLSSHEPKPESERAGGLASNRSK
FT                   LKTPGLGYVRDWERGRQVSNPFGELSRVLFSEPSGELAGAETVHGTLGVRCLLAVRILG
FT                   GGCVGCDGGADGCLYSCREASKGILRGKTLSQSKKKERKSALA"
     atggagggcg tgcccgccca cctcgcagcc tgcggcatcc taattatcca cgtgctagca        60
     tgcactcagc tttcttctca tgaacccaag ccagaatcag agagggctgg tggcctagcc       120
     agtaacagat ccaagttgaa aacgcctggg ttgggatacg tcagggattg ggaaaggggc       180
     cggcaggtgt ctaatccttt cggggaattg agtcgcgtgc tcttttcgga gccgtcgggg       240
     gagctcgcgg gggccgaaac agtgcacggt acgctcggcg ttcgatgttt gttggccgtg       300
     cggattttgg gaggagggtg cgttggctgc gacggaggtg ctgatgggtg tctatacagt       360
     tgtcgagaag cgtctaaggg tattctaaga ggaaagacgt tgtcacagtc gaagaagaag       420
     gagagaaaat ccgcgttggc ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page