(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE333

PENCW_16.PE333       Location/Qualifiers
FT   CDS_pept        join(complement(764445..764534),complement(764370..764390),
FT                   complement(763961..764311),complement(763694..763891),
FT                   complement(763555..763639),complement(762842..763498),
FT                   complement(762666..762778))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000046192" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128990"
FT                   /orf_name="Pc20g03330"
FT                   /product="Pc20g03330 protein"
FT                   /function="binding"
FT                   /function="glucose-6-phosphate dehydrogenase activity "
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85662.1"
FT                   /db_xref="GO:0004345"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniParc:UPI0001831D66"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG21"
FT                   /transl_table=1
FT                   /translation="MDMAFSTIELKDDTIIVVLGASGDLAKKKTFPALFGLFRNKFLPK
FT                   DIRIVGYARTKMDTDEYLKRVRSYIKVPTKEIEDQLDQFCKMCTYVSGQYDQDDSFINL
FT                   NKHLEEIENNRQSKEQNRVFYMALPPSVFTTVSDQLKRNCYPKSGLARIIVEKPFGKDL
FT                   QSSRDLQKALEPNWKEEEIFRIDHYLGKEMVKNILILRFGNEFFNATWNRRHIDNVQIT
FT                   FKEPFGTEGRGGYFDEFGIIRDVMQNHLLQVLTLLAMERPISFSSEDIRDEKVRVLRAM
FT                   DAIEPKNVIIGQYGRSLDGSKPGYLEDDTVPKESRCPTFCAMVAYIKNERWDGVPFILK
FT                   AGKALNEQKTEVRIQFKDVTSGIFKDIPRNELVIRVQPNESVYIKMNSKLPGLSMQTVV
FT                   TELDLTYRRRFSDLKIPEAYESLILDAFKGDHSNFVRDDELDASWRIFTPLLHYLDDNK
FT                   EIIPMEYPYGSRGPAVLDDFTASYGYKFSDAAGYQWPVTTSAPNRL"
     atggatatgg cattcagcac catcgaactt aaagatgata ccatcatcgt ggtactaggc        60
     gcatctggtg atctggcgaa gaagaagacc ttccctgcac tctttggcct tttccgcaac       120
     aaattccttc ccaaggacat tcggatcgtc ggatatgcgc ggacaaagat ggacaccgac       180
     gaatacctca agcgcgtccg ctcgtacatc aaggtcccca caaaggagat cgaagatcaa       240
     ttagatcagt tctgcaagat gtgcacctac gtttctggcc aatatgatca agacgattcg       300
     ttcatcaact tgaacaagca ccttgaggag atcgaaaaca accgccaatc gaaggagcag       360
     aaccgcgtgt tctacatggc attgccgccc agtgtcttca ccactgtgtc tgaccagctg       420
     aagcgcaact gctaccccaa gagcggtctc gctcgcatta ttgtcgagaa gcccttcggt       480
     aaggatctac agagctcccg agacctccag aaggctttgg agcctaactg gaaggaggag       540
     gagatcttcc gtatcgatca ctacctcggt aaggagatgg tcaagaatat cctaattctg       600
     cgattcggca acgagttctt caacgccaca tggaaccgcc gtcacatcga taatgttcag       660
     attacattca aggagccttt cggcactgag ggccgtggtg gttacttcga tgagttcggt       720
     attatccgtg atgttatgca gaaccacctt ctgcaggtcc tcacattgct cgccatggag       780
     cgtcccattt ccttctcttc cgaggatatc cgtgatgaga aggtccgtgt tctccgcgct       840
     atggatgcta ttgagcccaa gaacgttatc atcggccagt acggccgctc cctcgacggc       900
     agcaagcccg gctacctgga ggacgacact gtgcccaagg agtcgcgttg cccgactttc       960
     tgcgcgatgg ttgcatacat taagaacgag cgttgggacg gcgttccctt cattctcaag      1020
     gccggaaagg ccctgaacga gcagaagacc gaggtccgca tccaattcaa ggacgtcact      1080
     tccggtatct tcaaggacat cccccgtaac gagcttgtca tccgtgttca gcccaacgag      1140
     tccgtctata tcaagatgaa ctccaagctg cccggtctct ccatgcagac ggtggtcacc      1200
     gagctggact tgacctaccg ccgtcgcttc tccgacctca agatccccga ggcctacgaa      1260
     tccctgattc tggatgcctt caagggcgac cactccaact tcgttcgtga cgacgagttg      1320
     gatgccagct ggcgcatctt cactcccctc ctgcactact tggatgacaa caaggagatc      1380
     atccccatgg agtaccccta cggctcccgt ggacccgccg tccttgacga cttcactgct      1440
     tcatacggct acaagttcag cgacgccgct ggctaccagt ggcccgtcac tacctcggcc      1500
     cccaaccggc tgtag                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page