(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE334

PENCW_16.PE334       Location/Qualifiers
FT   CDS_pept        join(766904..766928,767062..767071,767214..767267,
FT                   767332..767474,767572..767669)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948869"
FT                   /orf_name="Pc20g03340"
FT                   /product="Pc20g03340 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85663.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018266"
FT                   /db_xref="UniParc:UPI0001831D67"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG22"
FT                   /transl_table=1
FT                   /translation="MPSEQGHRLYVKGRHLSFQRSKHALTQNTSLVKIEGVDDTKAAKF
FT                   YLGKKVAFVYRAKREVRGSNIRVIWGKVTRPHGNSGVVRAKFRNNLPPKSLGATVRVML
FT                   YPSNI"
     atgccttcgg aacaaggaca ccgcctctac gtcaagggac gtcacctgag cttccagcgc        60
     agcaagcacg ccctcaccca aaacaccagt ctggtcaaga tcgagggtgt tgatgacacc       120
     aaggccgcca agttctacct cggcaagaag gtcgctttcg tttaccgtgc taagcgtgag       180
     gtccgcggct ccaacattcg ggtgatctgg ggcaaggtca cccggccgca cggcaactcc       240
     ggtgttgtgc gcgccaagtt ccgcaacaac ctccccccca agtccctcgg cgctaccgtc       300
     cgcgttatgc tctacccctc caacatctaa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page