(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE335

PENCW_16.PE335       Location/Qualifiers
FT   CDS_pept        join(complement(768621..769349),complement(768554..768577),
FT                   complement(768446..768466))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948870"
FT                   /orf_name="Pc20g03350"
FT                   /product="Putative uncharacterized protein Pc20g03350 "
FT                   /protein_id="CAP85664.1"
FT                   /db_xref="UniParc:UPI0001831D68"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG23"
FT                   /transl_table=1
FT                   /translation="MAWSTRNSIIPESSFPWSDGELENWRTEYLKQPETLFMSPSPDPS
FT                   TTTRTPTARPPSYNYQQQLPSNQLPSAQFPSTPVALGTMLSPTPSSSYLDPSTIKRSIS
FT                   NHSPRSVPTQATATVLSPASLYDVRCPSPWDDLPVSTPIIKETLQSESDEVRTEPSQTK
FT                   MPCLTRRRTTKRKCVFCSLLKAIMSIRMLNICRLEKPRITELSNANGRTVNMTVCSRAK
FT                   VCSSGTFRHSISILGLSSVPGTIDSQGNVWSSDWI"
     atggcgtggt caacacgcaa ctcgattatc ccggagtcct cgtttccgtg gtctgatggc        60
     gagttggaga attggagaac cgagtatctc aaacagcccg agactctttt catgtccccg       120
     tcgcctgatc catcgaccac cacgaggacg cccactgctc gacctccttc atacaactat       180
     cagcagcagc tcccctccaa ccagctgccc tccgcacagt tcccctccac gccggttgcc       240
     cttgggacaa tgctgtctcc tactccttcg tcgtcgtacc tagacccaag caccatcaag       300
     cggtccatca gcaaccacag cccaagatcc gttccaaccc aggcaactgc aaccgtactc       360
     tccccagcaa gcctctacga cgttagatgc ccaagtccat gggatgatct accagtctca       420
     acgcctataa taaaagagac gctccagtca gagtcggatg aggtaaggac ggagcctagc       480
     cagacgaaaa tgccgtgtct tactcgtcgc cgtacaacca aaagaaagtg tgtattttgt       540
     tctcttctta aagctatcat gagtatacgc atgctgaaca tatgtcgtct agagaaaccg       600
     aggattacgg aactttcaaa tgcgaatgga aggactgtca atatgaccgt ctgttctcgc       660
     gcaaaggtgt gctcaagcgg cacattcaga cacagcatct caatcctcgg gctttcaagt       720
     gtccctggta caatcgattc acaaggaaac gtttggagtt cggattggat ttag             774
//

If you have problems or comments...

PBIL Back to PBIL home page