(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE336

PENCW_16.PE336       Location/Qualifiers
FT   CDS_pept        join(771693..771790,771850..772083,772143..773887,
FT                   773946..774676)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000031440" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977856"
FT                   /orf_name="Pc20g03360"
FT                   /product="Pc20g03360 protein"
FT                   /function="molybdenum ion binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAP85665.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniParc:UPI0001831D69"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG24"
FT                   /transl_table=1
FT                   /translation="MDIGVRDGKVVGVRGRVSDRVNKGRLGPKGLHGWASINHADRLKH
FT                   PLIRRNGKLERASWDEAMSLIVDKAHEVQSRLSNHGIGFYTSGQLFLEEYYVLAMVGKA
FT                   GLNTLHMDGNTRLCTATAAASMRESFGSDGQPGSYSDIDYTDCLFLVGHNMAHTQTVLW
FT                   SRVLDRLQGPQPPKLIVVDPRRSDTAKQADVHLAPKNGTNVALLNGLQYLLFSNGWINE
FT                   DYVSKHVVGLEDLRTVVNRYTPDVVERITGVPVTQLHQAAEILGTTSSLLSTALQGVYQ
FT                   SNQATASACQINNINLLLGLIGKPGSGILQMNGQPTAQNNRETGCDGEYPGFRNFQNPT
FT                   HIQEIADIWNIEPVKVPHWNLPTHVENMLKYISDGSIKMFWISGTNPLVSLPHLQKVRE
FT                   LLTKPELFVVTQDIFLTETAAISDVVLPAAQWGEKTGCFTNADRTMHLSQKAVEPPGQS
FT                   KADMDIWLDFARRMDFQDKDGKPLIPFTSAEEVFNAWRKMSCGRPLDCTEMSYQKLAGG
FT                   SGIQWPCTSVYPQGKERLFDDAKFFTDTAYCESYGHDLETGAPFTKSQYEAMNPAGRAI
FT                   LKAAHYQLPLEETSEQYPLRLTTGRNVYQFHTRTKTGRSKRLQEAYPEPVIQVSIADAD
FT                   ALHLVDGEMVVVRSRRGSVELPVVIGDITEGHVFIPFHFGYFDATDDRARAANELTREQ
FT                   WDPVSKQPMFKSGAVRIEKCVQIEGGKTNHAKEKHTEAVRSVEKGKGMAEPADENGGHT
FT                   GNKEPVRRLELWMGALNEGLEILVEIYRDLVPRLVHDLEVQSGLEVMRRLTTEVLHQFK
FT                   PVIDRYHGSHQYGRTVAQYLQKAVFPAVEETNDPYEALAALQSLDLFLTYIEGHLTALS
FT                   PASQALWDSEFVNVISSAQGSIQRQKAWVNQHIKVKSPQTLLVPTVAAEDLYDSQSSMA
FT                   GRIRS"
     atggacatcg gcgtgagaga tggcaaagtc gttggcgtac gtggtcgtgt ttccgaccgc        60
     gtcaataagg gacgactagg cccaaagggc ttgcacggat gggcctcaat taaccacgcc       120
     gaccgcctta aacacccgct gattcggcga aacggcaaac tcgaacgggc gtcatgggat       180
     gaggctatgt cattgattgt tgacaaggcg cacgaggttc aatctcggct atcaaatcat       240
     ggcattggct tttacacctc aggtcaactg tttctggaag agtactacgt ccttgctatg       300
     gtaggcaagg ccggtctcaa tacgctgcac atggacggta atacgcgttt atgcactgca       360
     acggccgcag ctagcatgcg tgaatctttt ggtagtgacg gccaaccggg atcttacagc       420
     gacatagact atacggactg ccttttcctg gtaggccaca acatggcgca cacccaaacg       480
     gttctgtggt cgcgtgttct agatcggcta caaggacccc aaccgcccaa acttattgtc       540
     gtggatccga gaaggtcaga cacagcaaaa caggcggatg tgcatctggc accaaagaac       600
     gggacaaacg ttgctttact caacggcctg cagtatctgt tatttagcaa tgggtggatc       660
     aacgaggatt atgtttcaaa gcatgttgtg gggctcgagg acctccgtac ggttgtgaac       720
     cggtatactc ccgacgtcgt cgaaagaatt acaggcgtcc ctgttacgca gctccaccaa       780
     gccgcagaga tacttgggac cactagtagt ctgctgtcca ctgccttaca gggagtgtat       840
     caatcaaatc aggcgactgc atctgcttgt cagatcaaca acatcaacct gctgcttggc       900
     ctaataggca aacctggaag cggtattctt caaatgaatg gacaacccac tgctcagaat       960
     aaccgggaaa ccggctgcga cggcgagtac cctgggtttc gaaacttcca gaaccctaca      1020
     cacattcaag aaatcgccga tatttggaac attgagccag tcaaggtccc tcactggaat      1080
     ctacccacgc acgtggagaa tatgctcaaa tacatcagcg acggttcgat taagatgttc      1140
     tggatctctg gcaccaatcc tcttgtcagt ctgccgcacc tacagaaggt tcgggaattg      1200
     ttgaccaaac cggaattgtt cgttgtgacc caagacatct ttttgactga aactgctgcc      1260
     atctcagacg tggttctccc tgctgcccag tggggagaga aaacaggttg ctttaccaac      1320
     gctgaccgga ccatgcattt atctcagaaa gcggtcgaac cgccaggcca gagcaaagcc      1380
     gacatggata tatggctaga ttttgcgagg cggatggact ttcaagataa agatgggaag      1440
     ccactaatcc cgttcaccag cgctgaggag gtctttaatg catggaggaa gatgtcttgt      1500
     ggccgcccat tggactgcac cgagatgtcg taccagaagt tggctggtgg ttcgggcatt      1560
     caatggccgt gcaccagcgt atatccccag ggcaaggaac gcctatttga tgacgcgaaa      1620
     ttctttaccg ataccgcata ctgcgagtct tacggacacg atctcgaaac aggtgcgcct      1680
     tttacaaaat cgcaatatga agccatgaat cctgcagggc gagccattct taaagcggcg      1740
     cactaccaat tgccgcttga agaaaccagt gaacaatacc ctctgcgact cacaactggc      1800
     cgcaatgtct accaattcca tacacgtaca aaaactggtc gctctaagcg attgcaggag      1860
     gcataccccg aacccgtcat tcaggtttct attgcagacg cagacgccct gcatcttgtg      1920
     gatggagaaa tggtcgtggt cagatcacga cgtggcagtg ttgaattacc ggttgttata      1980
     ggtgacataa ctgagggtca tgtcttcatt ccgtttcatt ttggctactt tgatgccaca      2040
     gatgacaggg cacgtgcagc aaatgaatta acccgcgagc aatgggaccc tgtctcgaag      2100
     caacccatgt tcaaatccgg agctgtccgt atcgagaaat gcgtccagat agagggaggg      2160
     aagaccaatc acgctaaaga aaagcacact gaagctgtcc gaagcgtcga aaagggcaaa      2220
     ggaatggcag agcccgctga cgaaaacggt ggccacaccg gcaacaagga acccgtgcga      2280
     cggctcgaat tgtggatggg agccttaaat gaaggcctcg agatacttgt tgaaatttac      2340
     agggacttgg tacctcgttt agttcacgat ttggaggttc agagtgggct ggaggtaatg      2400
     cgtcgcctga caacagaggt cttgcatcag ttcaagccgg tgattgatag atatcacgga      2460
     agtcatcaat acggtcgaac agtcgcccag tatctgcaaa aagctgtctt tccggcggtc      2520
     gaggaaacca acgacccata cgaagcatta gcagctctgc aatccctgga tctattccta      2580
     acctatatcg aaggtcatct tacagcatta tcgcctgcta gtcaagctct gtgggatagc      2640
     gagtttgtga acgttatctc ttctgcccaa ggcagcatcc agagacaaaa ggcgtgggtc      2700
     aatcagcata taaaggtcaa aagcccacag acccttctag tcccaacagt cgctgcggaa      2760
     gatctttacg actcccagtc gagtatggcc ggacggatac gatcttag                   2808
//

If you have problems or comments...

PBIL Back to PBIL home page