(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE339

PENCW_16.PE339       Location/Qualifiers
FT   CDS_pept        join(complement(778205..778671),complement(777936..778137))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948871"
FT                   /orf_name="Pc20g03390"
FT                   /product="Pc20g03390 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP85668.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831E4E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG26"
FT                   /transl_table=1
FT                   /translation="MAGPPHHVPLSASGTPGQDESTRDLYLPYGYAAHQYPPSLAAEPS
FT                   TFSENHLLYNTLMQHSSAPVHLSYSMPFSSAHGTFNPASHNMAHHPSSENNTPSDPSTM
FT                   GYISSGYSTACTTPLGSGRSSPSMQEIPQSSVSRPEVPTICGRGRAHRPKHDELYGMYQ
FT                   CNWKDCKYRGMFSRKGVLMRHIETQHVAPHSFDCPVCGKLFCRRDNMTEHLGKVQCQRV
FT                   "
     atggcaggac ctccacacca cgtccccttg agcgcttctg gtacacctgg tcaagatgag        60
     agtactaggg atctttacct tccctatggt tatgctgctc atcagtaccc tccctccctg       120
     gcggcagaac catcgacatt ctctgagaac catcttctgt acaatactct catgcaacac       180
     tcctcagctc cagttcatct cagctactcc atgcctttct cctcggctca tggcaccttc       240
     aatcctgcca gtcacaatat ggcacaccat ccctcgagcg agaataatac acctagtgat       300
     ccatccacta tggggtatat cagctctgga tatagtactg cgtgcactac accattagga       360
     tcggggcgat cctctccctc tatgcaggag atcccccaat caagtgtcag tagacctgaa       420
     gtcccgacca tctgtggcag gggtcgagca catagaccga aacacgatga gctctacggc       480
     atgtaccaat gcaactggaa agactgcaaa taccgcggca tgttctctcg gaagggcgtt       540
     ctcatgcgcc atatagaaac acagcatgtc gctccgcact cttttgactg ccccgtgtgt       600
     gggaagctct tctgtcgacg ggataacatg actgagcact tagggaaagt tcagtgccag       660
     cgggtgtga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page