(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE34

PENCW_16.PE34        Location/Qualifiers
FT   CDS_pept        join(complement(81164..81179),complement(80801..81105),
FT                   complement(80608..80742))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000187564" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946683"
FT                   /orf_name="Pc20g00340"
FT                   /product="Pc20g00340 protein"
FT                   /protein_id="CAP85363.1"
FT                   /db_xref="InterPro:IPR013879"
FT                   /db_xref="UniParc:UPI00018319DA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD1"
FT                   /transl_table=1
FT                   /translation="MTTLHYLPPVKPSAIALGTIFTHTASLGILAPVFGDTYHRAQAAN
FT                   SKEEFIKSKEAAGAAAAWGSSLAGSAVQTYGVAALINATGTLSYKGAAYLGTLIFFASS
FT                   APGIVSQVFSEKRPLDTIAVGAVSRVFETVGLSLFLTWWGTRTHPFD"
     atgactaccc tgcactacct ccccccagtg aagccctccg ccattgcgct gggtacaatc        60
     ttcacccaca ctgcctccct tggcatccta gcccccgtct tcggtgatac ttaccaccgc       120
     gctcaagccg ccaactcgaa agaggaattc atcaagtcta aggaggctgc tggcgcagcc       180
     gcagcctggg gaagctccct cgctggaagt gccgtgcaga cctacggtgt ggctgcactg       240
     atcaatgcca ccggcacact gagttacaag ggtgctgcgt acctgggtac acttattttc       300
     ttcgcaagct cagctccagg cattgtgagc caggtcttct ccgagaagcg acccctcgac       360
     actatcgctg tcggtgcggt ctcgagagtg ttcgagactg ttggactcag cttgttcctc       420
     acctggtggg gaacacgtac tcacccattc gactaa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page