(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE341

PENCW_16.PE341       Location/Qualifiers
FT   CDS_pept        join(781313..781391,781523..781635,781721..781895,
FT                   781971..782179,782310..782360,782425..782524,
FT                   782647..782905,783080..783266)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977857"
FT                   /orf_name="Pc20g03410"
FT                   /product="Putative uncharacterized protein Pc20g03410 "
FT                   /protein_id="CAP85670.1"
FT                   /db_xref="UniParc:UPI0001831E50"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG28"
FT                   /transl_table=1
FT                   /translation="MTYFSKCQNSLQYKQSAAAFPARAWVATTSSSLPLCLRHAGRPCG
FT                   SVDLGLNCAFSSIKAPASSVCLTNVCTTDNAINVKEANAHGPGAIVLQAACEDLPPSLD
FT                   AHAALTIATCVVAVNFLSGSFSTTAALIRWSRTAENNRIAHLFLVPTFPSRLIRRGSGL
FT                   VHRTGGRMLEVFNDVEKQASPISIDGRRSVFELALGGTRRWPDPSRALRRRTLRATVFL
FT                   SSPFTTLGRIDELQGFSHGSGQLVRETHSTWWGDPFSVVITGDRRREWCARAVQGARWI
FT                   YPGWVRIVTTRALSWSLGRLQLVECRSSLAWPAASAHWSQPSKIESPKLARMRISVSAA
FT                   PMQRMSPISSSVDWVPLFIHAELACFLYLRLGLHNEGYQSLEDAGTYGCD"
     atgacctact tttcaaagtg tcaaaatagc ctccagtaca aacagtccgc agcagccttc        60
     ccggcacgcg cttgggtagc cactacctcc tcctcccttc cactctgctt gcgacatgct       120
     ggacgtccct gtggctcggt tgacctaggg ttgaactgcg ccttttcatc aattaaggcg       180
     cctgcgtcct ccgtctgctt gaccaatgtg tgtaccacgg acaatgcgat caatgtcaag       240
     gaagcgaacg cacatggccc aggggccatt gttcttcaag cagcttgtga ggatctacca       300
     ccatcactcg acgcccacgc tgcattgaca atcgccacct gcgtcgtggc agtgaacttc       360
     ttgtccggca gtttctcgac aaccgcggct ctcatccgtt ggtctaggac cgcagagaac       420
     aacagaattg cacatctctt cctggtccca acttttccat cgaggttgat ccgtaggggg       480
     tcgggactgg tgcataggac gggcgggagg atgttggaag ttttcaacga cgtcgaaaag       540
     caggcatcac caatatcgat tgatgggagg cgaagcgtct ttgaactcgc cctcggcggc       600
     actcgacgat ggcccgatcc ttcgcgagct ctaagaagga ggactctccg tgcgactgtc       660
     ttcctctcta gcccgtttac caccctgggt cgcatagacg agctgcaagg tttcagccat       720
     gggtcgggcc agctcgtccg agagacgcac tccacgtggt ggggagatcc attctccgtt       780
     gtcattacag gcgaccgtcg tcgggaatgg tgtgcacgtg cggttcaagg cgctcgttgg       840
     atctaccctg ggtgggtcag gatcgtcacc acccgggctc taagttggtc cttgggtcgt       900
     ctccagctcg ttgagtgtcg ttcatcactg gcctggcccg ccgcatctgc tcactggtcg       960
     cagccttcca aaattgagag tccaaagctt gcaagaatgc gtataagcgt atctgcggct      1020
     cctatgcaaa ggatgtcacc aatcagctct agcgtcgatt gggttcctct ttttatccat      1080
     gcggagcttg cgtgtttcct ctatcttaga cttgggctcc acaatgaagg atatcaaagc      1140
     ttggaagatg cagggaccta tggctgtgac tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page