(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE342

PENCW_16.PE342       Location/Qualifiers
FT   CDS_pept        join(complement(784270..784272),complement(783889..784197))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824636"
FT                   /orf_name="Pc20g03420"
FT                   /product="Putative uncharacterized protein Pc20g03420 "
FT                   /protein_id="CAP85671.1"
FT                   /db_xref="UniParc:UPI0001831E51"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG29"
FT                   /transl_table=1
FT                   /translation="MFNYILHCPHSIYTSTKDAYSQWVSSRSSLVVPGDLAVNFDSEWA
FT                   KLSVESSHYPRLRAAEESARSWYTGVVAFRQDVRDLVDDFELGVAVGPFLQSHLANFP"
     atgttcaact atatactcca ttgtccgcac agtatatata cgtcgaccaa agatgcttat        60
     tcccaatggg tctcgtctcg ctcatcattg gtagtccccg gtgatctcgc tgtcaacttc       120
     gactcggaat gggccaagct ctcggtggag agttctcact acccccgttt gcgtgcagca       180
     gaggagtcgg ccaggtcctg gtacactggc gttgtcgctt tccgtcagga tgtacgggac       240
     ctggtcgacg actttgagct gggtgtagca gttggtccct tcctgcagtc ccacctggcc       300
     aacttccctt ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page