(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE343

PENCW_16.PE343       Location/Qualifiers
FT   CDS_pept        join(complement(787421..787651),complement(786956..787266),
FT                   complement(785678..786905))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160991" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948873"
FT                   /orf_name="Pc20g03430"
FT                   /product="Pc20g03430 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP85672.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831E52"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG30"
FT                   /transl_table=1
FT                   /translation="MTSERQQPDAASSNTEIDHANVEKPLDTPEQENEAAQPSDAENVP
FT                   EQPTEGAPLDQAPSQAAKMSKNKIIVVMTALCTIISTALPTIAAQFGASESGFSWIASS
FT                   YLLANAACIPLWGKISDIWGRKSIIVLANVVFLVGSLVCALAHNMTTIIAGRAVQGVGG
FT                   GGILILANISVSDLFSLRDRPMYYGLFGATWAVAGALGPVIGGAFTTNVTWRWCFYLNL
FT                   PVGGVSLLILILFLHIESPKTPFWAGMRCIDWTGTFLIIGGTLMFLFGLEFGGVNYPWD
FT                   SPTVICLIVFGVFTWALAMFLEWKVAKFPIIPPRLFNEWYNVLILLVCFCHGFTFIAAT
FT                   YYLPLYFQTVLQASPILSGVYVLPLVLSLAVGSMITGAVMKKTGRFREMIIGGMTLMAL
FT                   GFGLFIDLKVYASWPRIIIYQLIAGLGIGPNFQAPLVAFQANIRPADMATATATFGFVR
FT                   QLSTSMSVVLGTVIYQNIMGQQSAKLIASLGPETAAAISSSFGGSSKSLIESLTPSQRD
FT                   VVLGAYTHALNRMWIFYTATACLGFVLALFIRRRELTRHHTVQKTGLAEQERARQELID
FT                   SQRKANSKPETEA"
     atgacgagtg agcgccagca accagacgcc gcgagcagta atactgagat cgatcacgcg        60
     aatgtggaaa agcccctcga tacacccgaa caggaaaacg aggcagccca gcccagtgat       120
     gcggagaatg tgccggaaca gccaacggag ggtgcgcctc tcgaccaggc accctcacag       180
     gcagcaaaga tgagcaagaa caagatcatc gttgtgatga cagcgctatg tactattatt       240
     tccaccgccc tccccactat tgccgcccag tttggtgcct ccgagagcgg tttctcatgg       300
     atcgcatcgt catatcttct ggcgaatgcc gcctgtatcc cactgtgggg caagatcagt       360
     gatatctggg gaagaaagtc tatcattgtc ttggcaaatg ttgtcttcct ggttggcagt       420
     ctggtctgtg ccttggcgca taatatgacc acaattatcg caggtcgagc ggttcagggt       480
     gttggtggtg gtggtatcct tatcctggct aatatcagtg tttcggatct cttcagcttg       540
     agagatcgtc cgatgtacta tggtcttttc ggtgcaacgt gggccgtcgc aggtgctctt       600
     ggccctgtta taggtggagc tttcactacg aatgtgactt ggcgctggtg tttctatctc       660
     aaccttcctg ttggaggtgt ctcgcttctt atccttattc tcttccttca cattgagtcg       720
     cccaagaccc cattctgggc tggtatgcgc tgcattgatt ggacaggaac attcttaatc       780
     atcggtggaa cgctgatgtt cctcttcggg ctggagttcg gaggtgtcaa ctacccctgg       840
     gactcaccaa ctgtcatctg cctgattgtc ttcggggtct tcacttgggc tctggcaatg       900
     ttcctggaat ggaaggttgc taagttccca atcattcctc cgcggctctt caacgagtgg       960
     tacaacgttc tcatcctgct cgtttgtttc tgccacgggt tcaccttcat cgccgctacc      1020
     tactatctgc cgctttactt ccaaaccgtc ctgcaggcat cccccatcct gagtggtgtg      1080
     tatgtcttgc ctctggtact gtctcttgca gtcggctcca tgatcaccgg tgccgttatg      1140
     aaaaagactg gccgcttccg cgagatgatt attggcggta tgaccttgat ggccctcgga      1200
     ttcggtcttt tcatcgacct caaggtctac gcttcatggc cccgtatcat catataccag      1260
     ttaatcgctg gtctcggcat tggccccaac ttccaggcac ctttggtagc tttccaggcc      1320
     aacatccgtc ccgccgacat ggccacggca acagctactt tcggcttcgt ccgtcaactt      1380
     tccacttcga tgtccgtcgt tctgggcact gtcatttacc aaaacatcat gggtcaacaa      1440
     tcagccaagc tcattgcctc tttgggccct gaaaccgctg cggccatttc ttcttccttt      1500
     ggcggctcct ccaaatccct tatcgaaagc cttaccccct cccagcgtga cgtcgtcctc      1560
     ggcgcctaca cacatgccct gaaccgcatg tggatcttct acaccgccac ggcttgcctt      1620
     ggctttgttc tcgctttgtt catccgccgc cgtgagctga cgcggcatca cactgtccag      1680
     aagacgggcc ttgctgaaca agaacgtgcc cgtcaggagc ttatcgactc tcagcgaaag      1740
     gctaactcga aacctgaaac tgaggcctag                                       1770
//

If you have problems or comments...

PBIL Back to PBIL home page