(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE344

PENCW_16.PE344       Location/Qualifiers
FT   CDS_pept        join(788016..788104,788308..788547,788606..788729,
FT                   788784..788885)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948874"
FT                   /orf_name="Pc20g03440"
FT                   /product="Putative uncharacterized protein Pc20g03440 "
FT                   /protein_id="CAP85673.1"
FT                   /db_xref="UniParc:UPI0001831E53"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG31"
FT                   /transl_table=1
FT                   /translation="MARAQYLGSYQPPLTSTLPTILSTQVAISPAWSSSSSREVRAAPL
FT                   VGFSSVVQLPLLRGLDSLAAGEVGGLLTAELLDCGSGGLQAKRGVAGELPQGLAYHHGT
FT                   ESTYHGGAHVRGAGEIGVETLCFALADKIYQYLPANEGLIGAKVDGNANVPQRANLHSS
FT                   REYAPFENKTFNGGAGSDANC"
     atggcacgag ctcagtacct aggtagctat cagccgccat tgacaagcac gctgccaacc        60
     atattgtcaa ctcaagtggc catttccccg gcttggtcct cctcgtcatc ccgagaagtc       120
     cgggcagcac ctttggtggg gttcagttca gtcgtccagc ttcctcttct tcggggattg       180
     gactctttgg cggcggggga ggtgggcggt ctgctgacgg ccgagctgtt ggattgcggc       240
     tccgggggtc tgcaggctaa aaggggtgta gctggagaac ttccacaagg gcttgcgtat       300
     catcatggga ctgagtcgac gtaccatggc ggcgcgcacg tgaggggtgc tggagagata       360
     ggcgtcgaga ctctttgctt tgcgttggcg gacaaaatct accagtacct tccagcaaac       420
     gagggtctca ttggcgccaa agtggatggg aatgcgaacg taccacagcg tgcgaatctt       480
     cacagttccc gagagtatgc tccttttgag aacaaaacct tcaatggcgg tgcggggtct       540
     gatgcgaact gttga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page