(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE345

PENCW_16.PE345       Location/Qualifiers
FT   CDS_pept        789927..791600
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977858"
FT                   /orf_name="Pc20g03450"
FT                   /product="Pc20g03450 protein"
FT                   /protein_id="CAP85674.1"
FT                   /db_xref="UniParc:UPI0001831E54"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG32"
FT                   /transl_table=1
FT                   /translation="MVHIHDLPIELLHLILSFFVSPDELELLSGDQARKAKDGKAHQLD
FT                   DEEYDDDEPDGIETLYNTCLVSRKFREVAQPLLFRELFDDGLTGGLTPTVPFIRTIYRR
FT                   PDLGKHVHQISILPFPFVSGDRKHLSADDSEPFKGGIKDLGLGDQEEAWTSALEESDLG
FT                   ILAALLANKAPNLRGLHLPVRYFWIEPFIQLFHLNPQFLSNLESIWIESDDEMSGFDIA
FT                   FYEKFLTLPKVRFSTFEYGDLFDESFPSTWLPGTLETQELAFHHCHIDAGAIKKLMQAC
FT                   KKLRTFTYNNFSLDPNDRRIMRAGTVPEFDANQAHEAALVQKDTLELFHLEYAMELPDV
FT                   EHIEQLVSSHVKVGSFRDFSVLHTILIPHAALPVHPQLPSSLRRLHITDCNSSIRELTQ
FT                   NIAADCKNGLYPKLTHIKVFAIDITQPIKLPGQRIPEGKTPEQCFLALQDMFKGTKVNF
FT                   RILPYELPDFDDYDDLDLDYDEDLGFEEDFLEPGFEEHPPGADPGSGPIPPRLLDLLMQ
FT                   RAMMDPEFAHLRPDEGGDGDSWETDDDDDSWESDDSDSGN"
     atggtacaca ttcatgacct gcccatagag ctcctacatc tcattctgtc tttttttgtc        60
     agcccagatg aactcgagct actgagcgga gatcaagcca ggaaagccaa agacggcaag       120
     gcgcatcaat tggatgacga agaatatgac gatgatgaac ctgatgggat tgagactctg       180
     tacaatactt gcctagtctc gcggaagttc cgggaggtgg cccaaccttt actcttccgt       240
     gagctgtttg atgatggttt gaccggtggt ctcactccga ctgtcccatt catcagaacg       300
     atatatcgtc gtccggatct cggaaagcat gtccatcaaa tttctatcct gcctttcccc       360
     ttcgtctcag gtgatcgtaa acatctttca gcagacgact ccgagccctt caaaggcgga       420
     atcaaggacc taggattggg cgaccaggag gaagcctgga cttcggctct ggaggaatcc       480
     gacctcggca ttttggcagc attgctagcc aacaaggctc ccaatcttcg tggactacat       540
     ctgccagtgc gctacttctg gatcgagcca ttcatccagc ttttccacct caatccccag       600
     ttcttgtcga acctggagtc tatctggatc gaaagtgatg acgaaatgtc cggcttcgac       660
     attgctttct acgagaaatt cctcaccctt cctaaggtca gattctcaac cttcgagtac       720
     ggtgatctct tcgatgaatc cttcccatct acctggctgc ccggaacgtt ggagacgcag       780
     gaactggcct tccaccactg ccacatcgat gccggcgcca tcaaaaagct tatgcaagcg       840
     tgcaagaagc taaggacatt cacctacaac aatttcagct tggaccctaa cgaccgacgg       900
     attatgcgtg cgggaacagt gcctgagttc gacgctaatc aggctcacga agccgccctt       960
     gtacaaaagg acactctcga gctcttccac ctcgagtacg caatggaact accggacgtc      1020
     gagcatatcg agcaactcgt ttctagccac gtcaaggttg gctcattccg cgatttctcc      1080
     gtcctccata ccatcctcat cccacacgct gctcttccag tacaccctca actcccaagc      1140
     tcgctacgga gacttcacat caccgactgc aactcgtcaa tccgggagtt gactcagaac      1200
     atcgcggcag attgtaaaaa tggtctctat ccgaagttga ctcacatcaa ggtattcgct      1260
     atcgacatca cgcagcccat taaacttccc ggacaacgta tcccagaagg gaaaacgcct      1320
     gagcaatgtt tcctcgctct gcaggatatg ttcaaaggaa ccaaagtgaa tttccggata      1380
     ttgccgtacg aattacctga ttttgatgat tacgacgatc tcgacctcga ttatgatgaa      1440
     gatctcgggt ttgaggaaga tttcctagaa ccgggattcg aagaacatcc accaggggcg      1500
     gatcccggct cgggtccaat cccgccaagg cttctcgatt tacttatgca gcgggctatg      1560
     atggaccctg aatttgcaca ccttcgccct gatgaggggg gtgatggcga ttcatgggaa      1620
     actgatgatg atgacgactc atgggaaagt gatgactccg attcaggcaa ctaa            1674
//

If you have problems or comments...

PBIL Back to PBIL home page