(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE346

PENCW_16.PE346       Location/Qualifiers
FT   CDS_pept        join(complement(793126..793166),complement(793042..793060),
FT                   complement(791981..792988))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948875"
FT                   /orf_name="Pc20g03460"
FT                   /product="Pc20g03460 protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAP85675.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0001831E55"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE4"
FT                   /transl_table=1
FT                   /translation="MAYNKSYNPDALPAHAEPEQVAQMLGNMNVSGQSHTSSHAPSHNQ
FT                   KPLPSRPPPQTSHSSGVPPRVPVSSAPPQHAYAAAPPRLDPQPHHSHSHSHSYGGRSSS
FT                   AHAPPPSQAPVHSQARPHPLHPSPPPQNYGFGPPPVHPQRNRPPPSSRPPQSPVPPPLT
FT                   APSDDPQQLFPLFRAANASHSGALTEGELGSALVNGDYTSFHPRTVRLMIRMFDRDGSG
FT                   TISFDEFVSLWRYLAAWRELFDRFDEDRSGRVSQPEFEKALVAFGYRLSGKFISVIFGV
FT                   FEGKAKQMSNAPKDARPPGMSFDLFVQACISLKRMTDVFKRYDEDRDGYITLSFEEALT
FT                   GKSCCSLCCCWGVSR"
     atggcctata acaaatccta caaccccgat gcgctgccag cacacgctga gccagaacag        60
     gttgcgcaga tgctaggcaa catgaatgta tcaggccaaa gccacacctc gagccacgcc       120
     ccaagccaca accaaaagcc gcttccctct cgcccaccac cgcaaacaag ccacagcagc       180
     ggtgttcctc cccgcgttcc tgtatctagt gctcccccgc aacacgcata cgccgcagcg       240
     cccccgcgcc tcgaccccca accccaccac tcccactccc actcccactc ctacggcggc       300
     cgctcctctt cagcacacgc gcctccgccg agccaagctc ccgtccattc tcaagctcgt       360
     cctcaccccc tccacccatc cccgccaccc cagaactatg ggtttggacc cccgccagtg       420
     catccccagc gcaaccgacc cccgccctca tcgcggcctc cccagtcgcc cgtcccaccg       480
     ccattgacag cacccagcga tgacccgcaa caactcttcc ccctattccg cgccgcaaac       540
     gcatcccact ccggcgccct cacagaaggg gagctcggca gcgcgctcgt gaacggcgac       600
     tacacgtcct tccacccgcg gacagtcaga ttgatgatcc ggatgttcga ccgcgacggc       660
     agtgggacaa tcagcttcga cgagttcgtc tcgttgtggc ggtatctggc tgcatggcgg       720
     gagctgttcg atcgcttcga cgaggaccgc agtggccgtg tcagtcagcc ggagttcgag       780
     aaggcgcttg ttgcgttcgg ataccgtctt agtgggaagt tcatttctgt tatttttggt       840
     gtctttgaag gcaaggccaa gcagatgagc aatgcgccta aggatgctag gcctcctggt       900
     atgagctttg atcttttcgt tcaggcttgt attagtctga aacgtatgac ggatgtcttt       960
     aagcggtatg atgaggatcg ggatgggtat attactctga gctttgagga ggcgttgacg      1020
     ggtaagtctt gctgttcgtt gtgttgttgt tggggagtca gtcgctaa                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page