(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE347

PENCW_16.PE347       Location/Qualifiers
FT   CDS_pept        join(793877..795150,795203..797138)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948876"
FT                   /orf_name="Pc20g03470"
FT                   /product="Pc20g03470 protein"
FT                   /protein_id="CAP85676.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0001831E56"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE5"
FT                   /transl_table=1
FT                   /translation="MADPLSIASGVAGLLSLGVQVTKSLVDFYSAYKDQTPALAKITLN
FT                   LENLLGILQALDDARQHGQPQMDALVQEIDKAAVGCREIIEELSEECKKFQKDTALGLK
FT                   ARLQFVGRRATYPFRESTLKKLEEDIGEIRENLSLALNVLQLRNQTGLEYGISELKLLV
FT                   ERMNTIQISTTIRDWLRAPDATIDHNAACEKRHTSTGLWLVNGQKFQNWLVERNSFLWV
FT                   NGFAGCGKSVLCSTAIQYTVRERQHQPSVGIGFFYFSFNDESKRDCSGMLRALLLQLSA
FT                   QLQGAEGDIQELFKLYSSGTPPVKALLSSLRKTICRFNDTYILLDALDESPRGNKREGV
FT                   LDAVQTIRQWGLPTLHLLVTSRNEMDIRLTLEPPSSQDISMKNSDTDTDIQNFISYQLR
FT                   NDSKLRQWKSRHEEIQEKLTSKAQGVFRYVECQLLALKRARIRNHIDGCLRSLPRDLDE
FT                   TYERMLCSIDEQDAPEARLALTLLCVSDRPLTVEELIGALAIDVSKWQLDREGRSFSQD
FT                   HLLDICLGLIELAVVENEYSGEVSTIARIAHFSVQEYLKSDRISQQGAAKFAVQEELAE
FT                   TEMARVCLVYLLDPTLSDVESNEAMLEMFPLADFAAMEWSYFYKNSGKGKSDIKPLVLR
FT                   LFMDQPESFVTWVRVHDIDIGSPPMDLKRENIPPPLYYAIFLRLEFVFTAIIASFTEKI
FT                   TIDATLNTQEVVHEDVAQTMLDCRVGVNAQGGYYGNALQAASCGLFGDSVEEEDRQWEA
FT                   VEKMMQTLLDHGADVNAQGGIYGNALQAASYAGRERAVQTLLDHGADVNAYGGVYQTAL
FT                   QAASNPGHEALVRILLDRGADVNAREGTDASALEVASYYGHEKVVQILLDRGANINRDD
FT                   EYANALVFASYGGREKVVQMLLDRGSDVYVQEDLCKALEAASREGKEQVVQILLDRGAD
FT                   IDAQADGEYGNALQAASYAGQDKVVRMLLDRGADINTQGGDYGNALQAASWDGQEKVVQ
FT                   ILLDRGADVNAQGGGKYGNALQVASYMGHEKVVQILLHHGADVSAEGGENGNALRAALQ
FT                   EGHEKLVQILLDNGAKPEPIV"
     atggctgatc cgttgtctat cgcatctgga gttgccgggt tgctatcact gggtgtccaa        60
     gtgaccaaat ctctagtcga cttttactcc gcatacaagg atcagacccc tgctctggcc       120
     aagatcacgc tgaatcttga gaacctactc ggtatcctcc aggcacttga cgatgcacga       180
     caacatggtc aacctcagat ggatgccctg gtccaagaga tcgacaaggc ggcagtggga       240
     tgtcgcgaga tcatcgagga actcagcgag gaatgcaaga aattccaaaa agataccgcc       300
     ctgggtctga aagctcgatt acaatttgtc gggcgcaggg caacttatcc atttagggaa       360
     agtactctga agaagcttga agaggacatc ggcgagatac gggaaaactt gtctcttgca       420
     ttgaatgtgc tacagcttag gaaccagact ggacttgaat atgggatctc tgagctcaaa       480
     ctactcgtcg aacggatgaa cacgattcaa atctctacta cgattcgtga ttggcttagg       540
     gccccagatg caaccattga tcacaacgcc gcgtgcgaga aacgccatac aagtacagga       600
     ctatggttgg tcaacggcca aaaatttcag aactggctgg ttgagcgcaa ttcatttctc       660
     tgggttaatg gcttcgccgg gtgtggcaag tcggtcctat gctcgacagc aattcaatat       720
     acagtccgtg agaggcaaca ccagcctagc gtaggaatcg gtttcttcta cttttccttc       780
     aatgacgagt caaagaggga ttgttccgga atgttacgcg cattgttgtt gcagctatcg       840
     gctcaacttc agggggccga aggagatata caagaactgt ttaagttgta tagttcgggc       900
     actccgccag tgaaagcctt acttagctcc cttcgaaaga caatatgcag gttcaacgac       960
     acctacattt tgttagacgc attggatgag agcccccgag gcaataaaag agagggcgtt      1020
     ttagatgcgg tacagacgat tcggcagtgg ggcttgccca ccttacatct cctagtgacc      1080
     agccgtaacg aaatggacat ccgccttact ctggaacccc cctcgtccca ggatatctca      1140
     atgaaaaatt cggacacgga tacagatatc caaaacttca tttcctacca gcttaggaat      1200
     gactccaagc ttcgacaatg gaaatcacgc catgaagaga ttcaagagaa actgacgagt      1260
     aaagcccagg gggtattcag gtatgtcgaa tgccaactcc ttgccctaaa acgggcccgg      1320
     atccgaaatc acatcgatgg atgtctgcgt tctttgcccc gtgatctcga cgagacttat      1380
     gagcgaatgc tgtgcagcat cgacgagcaa gacgccccag aagcacggct ggcgttaact      1440
     ttactttgtg tgtctgatcg gccactcact gtggaggagc ttatcggtgc cctcgctatt      1500
     gatgttagca agtggcaatt agatcgtgag ggtcggtcat ttagccaaga tcatcttctc      1560
     gacatctgtc ttggtcttat agagctcgca gtggttgaaa acgagtactc tggagaagtg      1620
     agtacgatag ctcgtatagc ccacttctcc gtgcaggagt accttaaatc agatcgaatt      1680
     tcgcaacaag gtgcagcaaa atttgccgtt caagaagaac tggccgagac ggagatggct      1740
     cgcgtttgcc tcgtttacct cctagatcca acgctgtcgg atgtagaatc caatgaagca      1800
     atgctggaga tgttcccttt ggctgacttt gccgctatgg aatggtccta cttttacaaa      1860
     aattccggaa aagggaagtc cgacattaaa cccttagtct tgagactgtt tatggaccag      1920
     ccagagtcat ttgtgacatg ggtacgggtg catgacatag atattgggtc gccaccaatg      1980
     gatcttaagc gtgaaaatat cccgccgccc ttatactacg caatcttttt gagactggag      2040
     ttcgtcttca ctgccataat agcgagcttc acggagaaga tcacaataga tgccactttg      2100
     aatactcagg aggtggtaca tgaggatgtg gcgcagacca tgctagattg ccgtgtcggc      2160
     gtcaatgctc aagggggtta ttatggcaat gcactccaag ctgcatcatg cggattattt      2220
     ggcgactctg tcgaggagga agatcgccaa tgggaggcgg tggagaagat gatgcagacc      2280
     ctgctagatc atggtgccga tgtcaatgcc caagggggta tctatggcaa cgcgctccag      2340
     gctgcatcgt atgcgggccg tgagagggct gtacagaccc tgttagatca tggtgccgat      2400
     gtcaatgcct atgggggtgt ctatcaaact gcgctccagg ccgcgtccaa ccccggccat      2460
     gaggcgttgg tacggatcct gttagatcga ggtgccgatg tcaatgccag agagggcaca      2520
     gatgccagcg cgctcgaggt ggcatcatac tacggtcacg agaaggtggt acagatccta      2580
     ctagatcgag gtgccaatat caaccgagac gatgaatatg ccaacgcact cgtgtttgca      2640
     tcatacggtg gccgggagaa ggtggtacag atgctgctag accgaggttc cgacgtctat      2700
     gttcaagagg atctttgcaa agcgctcgag gccgcatcac gtgaaggcaa ggagcaggtg      2760
     gtgcagatcc tgctagatcg tggtgccgat atcgatgccc aagcggacgg tgaatatggc      2820
     aacgcgctcc aggctgcatc atacgccggg caggacaagg tggtacggat gctgctagac      2880
     cgaggtgccg atatcaatac ccaaggaggt gattatggca acgcactcca ggccgcatca      2940
     tgggacggcc aggagaaggt ggtgcagatc ctgctagatc gaggcgccga tgttaatgct      3000
     caaggtggtg gtaaatatgg caatgcgctc caggtcgcat catatatggg ccacgagaag      3060
     gtagtgcaga tcctactaca tcatggtgcc gacgttagtg ctgaaggtgg tgaaaatggc      3120
     aacgccctcc gggccgcatt gcaagaaggc cacgagaagc tggtgcagat cctgctggat      3180
     aacggtgcta aacctgaacc cattgtttga                                       3210
//

If you have problems or comments...

PBIL Back to PBIL home page