(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE348

PENCW_16.PE348       Location/Qualifiers
FT   CDS_pept        join(complement(797572..798452),complement(797383..797518))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178410" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948877"
FT                   /orf_name="Pc20g03480"
FT                   /product="Pc20g03480 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85677.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001831E57"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE6"
FT                   /transl_table=1
FT                   /translation="MAGLLRLLKMQYTPPIDPKNVSFAGKIVILTGATSGLGFEAAIKI
FT                   LNLGVESLIIGSRSVEKGNKAKADLEKTTNRRNVVKVWELEMNSFQSVKGFAERVNRDL
FT                   DRVDIALLNAGLWNREYNQSPEGWEETLQVNTLSTSMLALLLLPKLKKSSYAENPAHLT
FT                   VVSSQQFVRVKPESVRTDDALLAHVNDPENFKGPKQYGISKLLLEYMMKHIANMVRDDD
FT                   GTHTLIVNTVSPGLCISALGRQYTHWWEKCCVWVLHRLFARSTEQGSRSLVSATLLGIE
FT                   SQGKCWRSEGYLDESAALTTGLEGEELQEKAWEEIISVLEVQAPEVSLISRGLYQGV"
     atggcaggcc tcctccgact ccttaaaatg cagtacaccc ctcccatcga tcccaaaaat        60
     gtatccttcg ctggaaagat cgtcattttg acaggcgcca cctctggtct tggcttcgaa       120
     gctgccatca aaatcctcaa tctcggtgtc gagtctctca ttatcggatc acgcagtgtg       180
     gaaaaaggca acaaggccaa agccgacctg gaaaagacca ccaaccgacg caacgtggtc       240
     aaagtatggg agctcgaaat gaacagcttc cagagcgtca aagggttcgc tgaacgcgtc       300
     aatcgcgacc tggaccgtgt cgatatcgca ttgcttaatg ctggtctttg gaatcgagaa       360
     tacaatcaat cccccgaggg ctgggaagaa actctacaag tcaacacact atcgacctcg       420
     atgctagcct tacttctact tcccaagcta aagaaaagct cctatgctga aaaccccgcc       480
     catctcaccg tcgtttcaag tcaacaattc gttcgtgtca aacctgaaag cgtccggacc       540
     gatgacgcgc tactcgctca cgtgaacgac ccggaaaact tcaaaggtcc taagcagtac       600
     ggcatctcga agcttctgct tgaatacatg atgaaacata ttgccaatat ggtgcgcgac       660
     gacgacggca ctcacaccct cattgttaat accgttagcc ctgggctgtg catctcggct       720
     ttgggtcgcc agtacactca ttggtgggag aagtgttgcg tttgggttct gcacagattg       780
     ttcgcacgga gcacagagca agggagccga tcgctggtta gcgcaacgct ccttggcatc       840
     gaatctcagg gaaaatgctg gcgcagtgag ggatatctcg atgagtcggc tgcattgact       900
     actggattgg agggggagga actccaggaa aaggcttggg aggaaattat ctccgtgctg       960
     gaggtgcaag cgccggaagt gtccctcatc tctcgtggac tgtaccaggg cgtttag         1017
//

If you have problems or comments...

PBIL Back to PBIL home page