(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE35

PENCW_16.PE35        Location/Qualifiers
FT   CDS_pept        join(complement(82771..82830),complement(82187..82695),
FT                   complement(82109..82133))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187575" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977335"
FT                   /orf_name="Pc20g00350"
FT                   /product="Pc20g00350 protein"
FT                   /protein_id="CAP85364.1"
FT                   /db_xref="InterPro:IPR016813"
FT                   /db_xref="UniParc:UPI00018319DB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD2"
FT                   /transl_table=1
FT                   /translation="MARGIVNAAKSASNAISINQKYSVQSTGVWERIRRLLAIAPERST
FT                   GVPLNAQYRLPTPGSVPPLAYDDPVTLPAGDIADNPYWKRDVRRSYPQLSTVRQADAVG
FT                   LLTVGSQAAPKEDVLKIGQAGEQQLVAVKEQGEERGLAALFEQDKKSVQGVLGANGLPP
FT                   NPCNINAAPKPSQSKYELGTENGYPEKYTCRTFV"
     atggctcgcg gtatcgtgaa tgccgccaag tcggcatcca atgccatctc tatcaaccag        60
     aaatactcag tccagtccac cggcgtctgg gagcgcatcc gtcgccttct cgctatcgcc       120
     cccgaacgct ctacgggtgt ccccctgaac gctcaatacc gtcttcccac cccgggatct       180
     gtgccccctc ttgcctacga tgacccagtc actctccccg caggcgatat tgccgacaac       240
     ccttactgga agcgggacgt tcggaggagc taccctcagc tgagcactgt gcgccaggcc       300
     gacgcagttg gtctgctcac agtcggaagc caggcggcac ccaaagagga cgttctcaag       360
     atcggacagg ctggagagca gcaattggtt gctgttaagg agcagggcga ggaacgcggc       420
     ctagcggctc tcttcgagca agataagaag agcgtccagg gtgtgttggg tgccaatggc       480
     ttgcccccca acccttgcaa catcaacgct gccccgaagc cttcacagtc taagtacgag       540
     cttggtacag agaacggcta ccccgagaaa tatacctgcc gcacttttgt ttga             594
//

If you have problems or comments...

PBIL Back to PBIL home page