(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE350

PENCW_16.PE350       Location/Qualifiers
FT   CDS_pept        join(802415..802509,802588..802619,802726..802775,
FT                   802866..802870,802948..803032,803086..803613)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000264264" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948879"
FT                   /orf_name="Pc20g03500"
FT                   /product="Pc20g03500 protein"
FT                   /protein_id="CAP85679.1"
FT                   /db_xref="InterPro:IPR006840"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniParc:UPI0001831E59"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE8"
FT                   /transl_table=1
FT                   /translation="MAAIAQGHKVHPDGRTWKSHFPKGDLWVFGYGSLIWKPPPHYDQR
FT                   IPGYISGYVRRFWQASTDHRGTPEQPGRVVTVIERTFWETLDDPIAHLESELSSTGKVW
FT                   GAAYHIPASHAEEVHDYLDEREIDGYSAHYTPFHPTVDVEGAGDSTGSSPIICMVYIGQ
FT                   PTNPQFLRDAAHREPQHVAQVISAGHGLSGKGSEYLFMLEKGLEGLGLGTADVHVTDLV
FT                   KRVKAIEAELAEAEEEEAEIKVTRSLEIPAEEVDRDGRETIE"
     atggctgcca ttgcgcaagg acacaaggtc catccagacg gtcggacgtg gaagagtcat        60
     tttcccaagg gtgatctctg ggtatttggt tatgggagtt tgatttggaa accgcctcca       120
     cattatgacc agcgcatacc gggctatatt agtggctatg tgcggcgttt ctggcaggcc       180
     agtaccgatc accgcggaac ccccgagcaa ccgggtcgag tagtcaccgt aattgagcga       240
     accttctggg agaccctgga cgacccgatc gctcatctag aatccgaatt atcctccaca       300
     ggcaaagtct ggggcgcagc gtaccacatc ccagcatccc acgccgaaga agtccacgac       360
     tacctcgacg agcgggagat cgacgggtac agcgcgcact acacgccctt ccacccgaca       420
     gtggacgtcg aaggagccgg cgactcgacc gggtcctctc caattatctg catggtctac       480
     atcggccagc caactaaccc gcagttcctg cgtgacgcgg ctcatcgcga gccgcaacat       540
     gtggcgcagg ttattagtgc tggccatggg ttgagtggga agggttctga gtatttgttc       600
     atgctggaga agggtcttga aggtcttggc cttgggactg cggatgttca tgtcacggat       660
     ttggttaaga gggttaaggc tattgaggct gagcttgcgg aggcggagga ggaggaggct       720
     gaaattaagg ttactaggtc tttggagatc ccggctgaag aggttgatcg tgatggtcgt       780
     gagacgattg aatga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page