(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE351

PENCW_16.PE351       Location/Qualifiers
FT   CDS_pept        join(complement(805295..805378),complement(805122..805228),
FT                   complement(804799..805063))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671927"
FT                   /orf_name="Pc20g03510"
FT                   /product="Pc20g03510 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP85680.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001831E5A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGE9"
FT                   /transl_table=1
FT                   /translation="MDFSGLSWHTSDDTLREGFQQFGEIQEAIVVKDRATQRSRGFGFV
FT                   RFATDAEADAALGAMNNQEFDGRVIRVDKAFDRPQRSEGGFQGRGGYNSQPQSSYQGGA
FT                   GGYAGYNNGGYNNGAAGGYGGGYNRGYNNYAPSGPAGYGAGGPGGYG"
     atggatttta gcggcctttc ttggcatact agcgatgaca ccttgcgcga gggtttccag        60
     caatttggcg agatccaaga agccattgtc gtgaaggacc gtgcgactca gcgcagccgc       120
     ggcttcggct tcgtccgctt tgctactgac gccgaggcgg atgctgcttt gggcgccatg       180
     aacaaccaag aatttgacgg acgggtcatt cgcgttgaca aagcatttga ccgcccccaa       240
     cgctccgagg gtggcttcca gggccgcggt ggatacaatt cccagccgca atctagttac       300
     cagggtggtg caggtggcta tgctggctac aataatggcg ggtacaataa tggtgccgct       360
     ggtggatacg gcgggggcta caaccgtggt tacaacaact atgctccgag cgggcccgct       420
     ggctacggcg caggtggtcc cggcggttat ggttag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page