(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE354

PENCW_16.PE354       Location/Qualifiers
FT   CDS_pept        join(810839..811464,811529..811826)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000107197" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824638"
FT                   /orf_name="Pc20g03540"
FT                   /product="Pc20g03540 protein"
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAP85683.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniParc:UPI0001831119"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF2"
FT                   /transl_table=1
FT                   /translation="MDTNGQVTDAPPAEKPTGGMQYLSDPSLNPPVAFATAPLTMSEYT
FT                   EKEVDEVTEMFKGLSKKKKPSKKSKTADAGDDEEAPAADGEFDPSALKKKKKSSSKSKK
FT                   ADATDFDAKLAEAGIAEEAGEEKPEEIPEGDLEAGTGIWAHDATQTIPYSLLVSRFFSL
FT                   IESHHPDLLATGAKSYKIPPPQCLREGNRRTIFANIADICKRMKRSEEHCTQFLFAELG
FT                   TSGSVDGSRRLVIKGRFQQKGIESVLRRYIVEYVTCKTCRSPDTELNKGENRLYFVTCN
FT                   SCGSRRSVAAIKTGFRSQIGRRKRVG"
     atggatacca acggccaagt cacagacgcc cctccggctg agaagcccac aggcggtatg        60
     caatacctct ccgatcccag cctcaatccc ccagtcgcgt ttgccacagc cccactaacg       120
     atgtctgaat atacagagaa ggaagtcgac gaggtcaccg agatgttcaa gggtctctca       180
     aaaaagaaga agccctccaa gaagtctaag actgccgacg ccggcgatga cgaggaagct       240
     cccgctgccg atggcgaatt cgatccctcc gcgctgaaga agaaaaagaa gagcagcagc       300
     aagtctaaga aggccgacgc caccgacttc gacgccaagc tcgctgaggc cggtattgct       360
     gaggaggccg gtgaggagaa gcccgaggaa atccctgagg gcgacctcga ggccggcacc       420
     ggtatctggg cgcacgacgc tactcaaacc atcccctact cgctcctcgt ctcccgcttc       480
     ttctccctca tcgagagcca ccaccccgac cttctggcca ccggcgccaa gtcctacaag       540
     attcccccgc cccaatgtct gcgtgaaggt aaccgtcgta ccattttcgc caacattgcc       600
     gatatctgca agcgcatgaa gcgaagcgag gaacactgca ctcaattcct gttcgccgaa       660
     ctcggtacgt caggcagtgt cgacggtagc cgtcgcctgg tcatcaaggg aagattccaa       720
     cagaagggta tcgaatcggt tctgcgtcgc tatattgttg agtacgtcac atgcaagacg       780
     tgccgcagcc ccgacaccga gctcaacaag ggagagaacc gtctgtattt cgttacttgc       840
     aactcctgcg gatcccgtcg ttccgtcgcc gccatcaaga ccggtttccg ttcccagatc       900
     ggccgcagaa agcgtgtggg ctaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page