(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE355

PENCW_16.PE355       Location/Qualifiers
FT   CDS_pept        join(complement(813652..813678),complement(813078..813597),
FT                   complement(812642..812991),complement(812361..812579))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824639"
FT                   /orf_name="Pc20g03550"
FT                   /product="Pc20g03550 protein"
FT                   /protein_id="CAP85684.1"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniParc:UPI000183111A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF3"
FT                   /transl_table=1
FT                   /translation="MNIPLRLCLLRRLRHVVTIPSIGSKAILMRRVAFSPPHQPYFAPP
FT                   PRQTPPSNGDHPVPQSSISPPAMSPPTNKQGYAMAEYPAPTTASPPPPDQIAEQNQAAF
FT                   LQNQALSRLSISSRPPQTVTMEKMPGGAPAYGQFVGTHSTYQDDVGVFNGGSYRISHRD
FT                   TNSLLTLQLAVGCPLTVRPGAMIAMSPTITLRGHVSFSFKKLIIGGSMTTSQYTGPGEV
FT                   LLAPPMLGDIVVLPIDTGEAWNAGRDSFLAHTSGVHHLYQSQGLSKGFFSGEGFFVYEF
FT                   TGHGLLWLQSFGAIVKKDLREGESYFVDNGHLVAWKCAYEIERPASGGLLSSFSSGEGL
FT                   ACRFKGPGTVYLQTRNLKAFATQMKVTSSYL"
     atgaatatcc ccctccgcct atgtctgctc cgccgactca gacatgtagt tactatcccc        60
     tcaatcggaa gcaaagctat actaatgcgt cgagtagcat tttcaccacc ccatcaacca       120
     tacttcgctc ctccacccag gcaaacgcct ccgtcaaatg gagatcatcc agtacctcaa       180
     tcctcaatta gcccacccgc catgagccca ccaacgaaca aacagggcta tgccatggcc       240
     gaatatccag ctcccacaac agccagtcca ccaccccctg atcagattgc cgagcaaaac       300
     caggcggcat ttcttcaaaa ccaggctctt agccggctgt cgatttcctc tcggccccca       360
     cagacagtaa cgatggagaa gatgcccgga ggggcaccgg cctatggaca gtttgtcgga       420
     acacactcga cttatcagga tgatgttggg gtattcaatg gaggcagcta cagaatcagc       480
     caccgagata ccaactcact tttgacactg caattggcag taggttgtcc tttgactgtt       540
     aggcctggtg caatgattgc aatgtcgcca acgataacgc taagaggaca tgtctcattc       600
     tccttcaaga aactcatcat tggtggcagc atgactacat cacaatacac aggcccgggg       660
     gaggtacttc tagcgccccc tatgctggga gatatcgttg tcctcccgat cgatacggga       720
     gaggcatgga atgccggaag ggattccttc ctagcccaca cctctggtgt tcatcattta       780
     taccagtccc agggtttgag taaagggttc ttctccggag aaggattctt cgtctacgag       840
     ttcacaggcc acggtttgct ctggttgcag agttttggag caatcgtcaa gaaagatctt       900
     agagaggggg aatcttactt cgtcgacaat ggtcaccttg ttgcatggaa atgcgcgtac       960
     gagattgagc gacctgcttc tggtgggctc ttgtctagtt tcagttctgg cgaaggacta      1020
     gcttgcagat tcaaaggccc aggaaccgta taccttcaaa ccagaaacct gaaggccttc      1080
     gctacccaga tgaaggtcac cagctcctat ttgtga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page