(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE356

PENCW_16.PE356       Location/Qualifiers
FT   CDS_pept        join(complement(818097..818189),complement(817454..818032),
FT                   complement(814603..817419))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234561" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948881"
FT                   /orf_name="Pc20g03560"
FT                   /product="Pc20g03560 protein"
FT                   /protein_id="CAP85685.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000183111B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF4"
FT                   /transl_table=1
FT                   /translation="MLSILFFISLFPFVKADDDWDDFTNNLATDLAPLITLFGERLTKQ
FT                   FLSESISILDNVIFALSPLGVLTAVVSVIRICGSSSLRAFVGRAQEGPAEAESELLPCV
FT                   SESTAELFNDGGITRVFGRPKIVEIVAWQDVNHKTGEKETKIGTLKDALEEKAWSCNNK
FT                   VLPTELPELDIPNLSLNKGIKRRDQFWFHCAAILGGVLQTGRCFSSFEPEITLTIHLRY
FT                   HYHFKKDDKAVASYAFPLYLIGTTLLFLGMFFCAFIMERSSKEFYLKAEKPSKIYWLQP
FT                   GNQDVGDQVFNAFLAVNEGPESSMTKKLRYTKSIRDRRFDRKYLEIYSTLTSTVLGFIF
FT                   QFIGLRGLHASVILAQLGSTFIMSIIRTCLRTERMAPDENKMKDDRDLMGHKQQELDAF
FT                   AFYLENVEYFNMVLLPDRPATIPSPRFVPHVDAPLARQLIRTRTQLANLTSNPNQSSSA
FT                   TWDDMPIRRMAHNLAQTIESTMDLISGWGVDLGKTFEFRLGFECRGASPGSVTQSPGTY
FT                   SIGLMRCGDALRWKMEASEIEAILGLWTWSLYKSGDDCKSSRLFRLVGLSEEEASKKET
FT                   YLYFHKWIFRQTEARLVPSDLIDDSRRLFGFEPKEGLPLGNLLVIKTENEVETMAAQDI
FT                   FIQFLKEVCLNVKELGGEVDVVSGIQNSLLGSCTRIDELVSCFEAHSLGSREDALLCIV
FT                   PVLRNRNLLPDLAADCAKVRARREQLISQGKWKNAFDLLRWLCERSEGPQFQRSVYELG
FT                   YLCLRALLNNSETVRKEGFAQVCKLLNSDIREEFLQTQKILLPSDWSMSQDRIEWWRSF
FT                   SSELGWTAWSISEEVPGMSFMEPALKSLNVPQSLPGVIGTGQDLQATEDAMRSMQDWLT
FT                   LRDLVNAGFRRLREEEDNRLCFEWAVENNYHCLLYFLLLKWVELNDRIPFLITIAYTLA
FT                   ATKHSHLATQTLLRQGTNIDATDVQGHTALFNQAAVGHVEGIVMLLDNGADPNGSNEAP
FT                   NARPLIAAVYGGHLMAVALLLQYGADANMTDQHGMSALLWAMASDYIDIVELLLSSGAE
FT                   TESVMSDGSTALIWASTDKSLPILELLIKHGADINAQDTDGKTALMRAVSRERSLPVLR
FT                   VLLDKGADVHMEDDKGRTALDMARKANFHEAVAILKSSDRNSLASWLPDLTSRSP"
     atgctttcta tacttttctt tatatctttg ttcccttttg ttaaggcgga tgatgactgg        60
     gatgatttta cgaacaatct tgctacggac ttggctcctc taatcacctt gttcggtgaa       120
     cgacttacga aacaatttct ctctgagtct atcagtattc ttgataatgt catcttcgcc       180
     ctttcgcctc taggggtctt gactgctgtc gtgtcggtga tcaggatctg tggaagttca       240
     tccctcagag cattcgtcgg acgagcacaa gaaggtcctg ccgaggctga gagtgaactc       300
     cttccttgcg tctcagaatc aactgcagag ctctttaatg acggtggcat cacacgagtc       360
     tttggccggc ccaagatcgt ggagatagtt gcttggcagg atgtgaatca taagaccgga       420
     gaaaaggaga caaaaattgg cactttgaaa gatgcccttg aggaaaaagc ttggtcttgc       480
     aataataaag ttttgcctac tgaactgcct gaactggaca ttccaaatct atccttgaac       540
     aagggaatca agaggagaga tcaattttgg ttccattgcg ctgcaatact tggtggcgta       600
     ctgcagactg gtcggtgctt ctcttccttt gagcccgaga taacactgac aatccattta       660
     aggtaccatt accattttaa gaaagacgac aaagctgtcg cctcatacgc attcccactc       720
     tatctcatcg ggacaaccct tctgtttctg gggatgttct tctgcgcatt cattatggaa       780
     cgttcttcga aggagttcta tctcaaagca gaaaagccaa gcaagatata ctggctgcag       840
     cccggtaatc aagacgtggg tgaccaggtc ttcaatgctt tcttggctgt caatgaaggg       900
     cccgagtctt caatgaccaa gaaacttcgt tataccaaat cgatcagaga tcgaagattt       960
     gatagaaagt atttggagat ttactctacc ctcacatcga cggttttggg attcatcttc      1020
     cagtttattg gactgagagg ccttcatgca tctgtcatcc tagcccagct tgggtccaca      1080
     ttcataatgt ctattatacg tacctgtcta cgcacagaaa gaatggcacc agacgaaaat      1140
     aagatgaagg atgaccgtga cctcatgggt cataaacagc aggagctaga cgccttcgct      1200
     ttttatctcg agaacgtcga atacttcaat atggtcttgc ttcctgatcg gccagccacg      1260
     ataccttcac caaggttcgt gcctcacgtt gacgcgccac tggccagaca gttgatccga      1320
     acacgaactc agcttgccaa tctcacatct aatccaaacc agagctccag tgctacctgg      1380
     gacgacatgc ctattcgacg aatggctcac aacctcgcgc aaacgatcga gtcgacgatg      1440
     gatttgatct ctggttgggg agtggacctc gggaagacct ttgagttccg gctcggcttt      1500
     gagtgcaggg gtgcttctcc aggttctgtc acccagtctc cgggaacata ttccattggt      1560
     ctcatgcgtt gtggtgatgc ccttcgatgg aaaatggaag ccagcgagat agaagcaata      1620
     cttggcctgt ggacctggtc tctgtataag tccggcgatg actgcaagtc ttcgagactc      1680
     tttcgtcttg tcggactgag cgaagaagag gccagcaaga aggagactta cctttacttc      1740
     cacaaatgga tattccggca aacagaggcc cgactggtcc cgtccgacct gattgatgac      1800
     tcccgacgat tattcggctt tgagcccaag gaaggtcttc ccttagggaa tcttctcgtt      1860
     atcaagactg agaatgaagt agagacaatg gctgcccagg atatcttcat tcagttcctc      1920
     aaagaagttt gcctaaatgt gaaggagctg ggcggtgaag tcgatgtcgt ctctggtata      1980
     cagaactcgc ttttgggttc ctgcacgcga atcgatgaac tggtatcctg ctttgaagcc      2040
     cattctcttg gatcaaggga ggatgcattg ctatgcattg ttcctgtttt gagaaaccga      2100
     aaccttctgc ctgaccttgc agctgactgc gctaaagtca gagcgcggag agaacagctc      2160
     ataagccagg gaaaatggaa aaatgccttt gatttgcttc gttggctctg tgaacggtca      2220
     gaaggtcccc aattccaacg gtcagtctac gagttaggat atctctgcct ccgggcattg      2280
     ttgaacaaca gcgaaactgt tcgcaaggaa gggttcgcgc aagtttgcaa gcttctcaac      2340
     tcagacataa gagaggagtt tctccagact cagaaaatac ttctgccttc tgattggtcc      2400
     atgtcacaag accgtatcga atggtggcgt tcattctcca gcgaactagg ttggacagca      2460
     tggagtattt cagaggaagt gcctggaatg agcttcatgg agccagcttt gaagtcactc      2520
     aatgtaccgc agagcttgcc tggtgtgatt ggcaccggcc aggacctgca agccactgaa      2580
     gacgccatgc gctctatgca ggattggctc acgctgcggg atcttgtgaa tgcggggttc      2640
     agacggctta gagaagaaga ggacaatcga ctatgctttg agtgggctgt tgaaaacaat      2700
     taccactgct tactttattt ccttctgttg aagtgggtgg agctcaatga ccgcatccca      2760
     ttccttatca caattgcata cactcttgcg gccacaaagc actcgcattt ggctacgcag      2820
     acccttcttc gacagggcac caacattgat gccaccgatg tacaaggcca cactgcgtta      2880
     tttaaccaag cggcagttgg acacgtggag gggatagtga tgttgttgga taatggcgcc      2940
     gatcccaatg gcagtaacga agctcccaac gcgaggccac tgatcgcagc ggtatatgga      3000
     gggcatctta tggccgtggc cttgcttctt caatatggag ccgacgcaaa tatgacggac      3060
     cagcatggaa tgtcggcgct gttgtgggca atggccagtg attatattga cattgttgag      3120
     ttacttttat ccagtggtgc tgagaccgag tcagtcatgt ctgatggctc gacagcactt      3180
     atttgggctt caacggataa aagtcttcct atcctggaat tgctgataaa gcatggagcg      3240
     gatatcaatg cccaagatac cgacgggaaa actgcactta tgcgggcagt gtctagagaa      3300
     cgttctctgc cagtgcttcg ggtactgttg gacaaaggag ctgatgttca tatggaagac      3360
     gacaaggggc gtacagccct ggatatggca agaaaagcga acttccatga ggctgtagcc      3420
     atactgaagt catcagatcg caactccttg gcatcttggc tacctgatct cacttcaaga      3480
     tctccttga                                                              3489
//

If you have problems or comments...

PBIL Back to PBIL home page