(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE357

PENCW_16.PE357       Location/Qualifiers
FT   CDS_pept        join(819423..819485,819548..819980,820032..820256,
FT                   820310..820365)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977859"
FT                   /orf_name="Pc20g03570"
FT                   /product="Pc20g03570 protein"
FT                   /protein_id="CAP85686.1"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniParc:UPI000183111C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF5"
FT                   /transl_table=1
FT                   /translation="MAASSEFASAMTTRSLRMVRTELEFLADASVITPQQLSSILSQLP
FT                   TDSETSRAVYTSPSPPRQQAQPAPAQHVPVQAQPPPAPYTPSYSPPVSQMNNVSINEKA
FT                   FMHNQHVPVQAQPPQAPPAYPQVPPVLGLASAMYAYTPTDAGDLALQPQDRIQIIEHMN
FT                   DDWWRGRNERTGQEGIFPRSYVNVVNEKAGISSPPPTNYGNMPLAVSQSGQPEDPNDPK
FT                   KNKFEEGGKKFGKKLGNAAIFGAGATVGSNIVNSIF"
     atggcggcct ccagcgagtt cgcatctgcc atgaccaccc ggtcgctccg catggtccgg        60
     acggaactag aattccttgc cgatgcctcc gtgatcactc cccaacagct ctcttccatt       120
     ctgtcacagc tacccaccga ttccgaaacc tctcgggcgg tgtacacatc accatcgccg       180
     ccccgacaac aggcacagcc tgcgcctgcc cagcatgtgc cagtgcaagc gcagccccct       240
     ccggcccctt acacgccctc atactcgcct cctgtctcac agatgaacaa tgtgtcgatt       300
     aatgagaaag cctttatgca caatcaacat gttccagtgc aagctcagcc cccgcaggcc       360
     ccgccagctt atccccaagt cccgccagtc ctgggtcttg cctcggccat gtacgcatac       420
     acacctaccg acgccggtga cttggccctg cagccgcaag atcgcatcca gattatcgag       480
     cacatgaatg acgactggtg gcgtggtcgc aacgagcgga ctggccagga gggtatcttc       540
     cctcgaagct atgttaacgt cgtgaacgag aaggctggca tttcttcgcc cccgcctaca       600
     aactatggga acatgcctct tgcagttagc cagagtggac agcctgaaga ccccaacgac       660
     ccaaagaaga acaagtttga ggaaggaggc aagaagttcg gaaagaaact gggcaatgcc       720
     gcaatcttcg gtgccggtgc tactgttggc tccaacatcg tgaacagcat cttctaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page