(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE358

PENCW_16.PE358       Location/Qualifiers
FT   CDS_pept        join(822108..822263,822325..822633)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977860"
FT                   /orf_name="Pc20g03580"
FT                   /product="Pc20g03580 protein"
FT                   /function="sequence-specific DNA binding"
FT                   /protein_id="CAP85687.1"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013729"
FT                   /db_xref="UniParc:UPI000183111D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF6"
FT                   /transl_table=1
FT                   /translation="MSDWESTTKIGSKFRGAGAQPRETVVKGKSALNAAQRSGSVYTEK
FT                   KYTTGNLSAKAGAPEGQHLTKVDRSDDIVKPKTVGHAVADAIKRRRTEEGYKMTQKELA
FT                   TKCNTTITIVQDFERGTATPDQKVLGSMERVLNIKLRGSDIGSEKFPKKK"
     atgtctgact gggaaagcac caccaagatt ggcagcaagt tccgcggagc tggcgctcaa        60
     ccccgcgaga ccgtcgtcaa gggcaagagt gccctgaacg ccgctcagcg ctctggcagt       120
     gtctacaccg agaagaagta caccaccggt aaccttagcg ccaaggcagg tgcccccgaa       180
     ggccaacact tgaccaaggt cgaccgcagc gacgatatcg tcaagcccaa gaccgtcggc       240
     cacgccgtcg ccgacgcaat caagagacgc cgcactgagg aaggctacaa gatgactcag       300
     aaggaactcg ccaccaagtg caacaccact atcaccattg tccaggactt cgagcgtgga       360
     accgccaccc ccgaccagaa ggttctcggc tctatggagc gtgtgctgaa cattaagctg       420
     cggggttcag acatcggctc tgaaaagttc cctaagaaga aatag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page