(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE359

PENCW_16.PE359       Location/Qualifiers
FT   CDS_pept        join(complement(824634..824660),complement(824061..824567),
FT                   complement(823890..824006),complement(823660..823836),
FT                   complement(823416..823598))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231322" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948882"
FT                   /orf_name="Pc20g03590"
FT                   /product="Pc20g03590 protein"
FT                   /protein_id="CAP85688.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000183111E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF7"
FT                   /transl_table=1
FT                   /translation="MRPILLSGHERSLTQIKFNSDGDLLFSVSKDKIVCAWWSANGERL
FT                   GTYNGHQGAVWTVDVSPNTILLATGSADNTVRLWNVKTGECVKVWEFSTAVKRVSFSPD
FT                   GNRLLAVTEKRMGFNGTIAVLDISYGENLSAQAAEPTLTIVCEESKATVAGWSFLSKYI
FT                   IAGHEDGSVSQYDPKSGDQLENVQIHEFDSQITDIQFAPDRLSFITASKDKSAKLLSSR
FT                   NLAILKTYISDTPLNTASVTPKKEFVILGGGQAAMDVTTTSARQGKFEARFYHKVFEDE
FT                   CGRVRGHFGPLNTIDVHPAGTAYASGGEDGYVRVHHFDKSYFDFMYEVEREQARK"
     atgcggccta ttttgctttc cggccatgag cggtccctga cccagatcaa gttcaacagc        60
     gacggcgatc tcctcttctc cgtctcgaag gataagattg tgtgcgcatg gtggtccgcc       120
     aatggcgaac gtctcggtac ctacaacggc caccagggtg ctgtctggac agtcgacgtc       180
     agccccaaca ccattcttct tgcgaccgga tcagcagaca acaccgtgcg tctatggaac       240
     gtcaagaccg gcgagtgtgt gaaggtgtgg gaattctcga cagccgtcaa gcgcgtgtca       300
     ttctcccccg atggaaacag acttttggca gtgacggaaa agcgcatggg tttcaatggt       360
     actatcgcgg ttctcgatat cagctacggc gaaaacctga gcgcacaggc cgccgagccc       420
     accttgacca tcgtttgcga ggagagcaag gccaccgtgg cggggtggag tttcctgtcc       480
     aagtacatca ttgcggggca cgaggatggc agcgtcagcc agtacgatcc taagtctgga       540
     gatcaactcg agaacgtgca aatccacgaa ttcgatagcc aaataaccga cattcagttc       600
     gcacccgatc gtctgtcttt cattaccgcg tcgaaagaca agtcggccaa gctcctgtcc       660
     tcccgcaacc tcgccatcct caagacctat atctccgaca ctcctctcaa cactgctagt       720
     gtgacaccca agaaggaatt cgtcatcctt ggtggtggtc aagccgccat ggatgtcacc       780
     accacctccg cccgccaggg taaattcgaa gctcggttct accacaaggt gttcgaagat       840
     gagtgcggcc gcgttcgtgg ccacttcggt ccccttaaca ctatcgatgt tcaccccgca       900
     ggcaccgcat acgcctctgg tggtgaggac ggatacgttc gtgtccacca cttcgacaag       960
     tcatacttcg acttcatgta cgaggttgag cgggagcaag cgcggaagta a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page