(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE36

PENCW_16.PE36        Location/Qualifiers
FT   CDS_pept        join(complement(85982..86175),complement(85920..85926),
FT                   complement(85704..85864),complement(85259..85647),
FT                   complement(84711..85199),complement(84203..84642))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946684"
FT                   /gene_name="Dip5"
FT                   /orf_name="Pc20g00360"
FT                   /product="Dicarboxylic amino acid permease Dip5-Penicillium
FT                   chrysogenum"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85365.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00018319DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD3"
FT                   /transl_table=1
FT                   /translation="MGHPDEINALEAQPGYVDNLGDFKESEQDEPVQLHRELKARHISM
FT                   IAIGGAIGTGLVVGTGSALTAGPGSLFIAYCFMGFVVWTVMCGLGEMAAWLPLSSGFTG
FT                   YAGRFCDPALGFTLGWCYYLKYIILPPTQLTAAALVITYWPRTSAENVNPGVWIAIFMV
FT                   AIIVINYFGVKIFGELEFWLSSFKVIVILGLILCSLIFALGGGPDHDRRGFRYWNKPGA
FT                   FATKYTDGALGKFLAFWSTMVQATFAFLGTELIGVTVGEAQNPRKTIPKAIKLTFWRII
FT                   VFYILSVLFLGMLVPYDSKELAFATEAESSAAASPFVVAMGQVAALPHIINGCILVFVF
FT                   SAANSDLYIATRTLYGLAREKKAPKIFARTNRAGVPIYSLALSASFCLLAFMSVSSTSK
FT                   EVFGYFTDMVSIFGLLTWVSLLITHIFFIRARRAQGVDQATLAYKAPLGIIGSCIALFF
FT                   CVLVLFTRSFGVFIHDPETYGNFDYKTFITSYIGIPLYVAAFAGWKIWNKTEIIKPHNA
FT                   DIWTGKAEIDREEAEYVAMVAIQDQNLSGWNKVYRKSLAWLF"
     atgggtcacc ccgacgagat taacgctctc gaggcgcagc ccggctacgt tgacaacttg        60
     ggagatttca aggaaagtga gcaggatgag ccagttcaac ttcacagaga gctcaaggct       120
     cgtcacattt ctatgattgc cattggtggt gccattggta ctggattggt cgttggtact       180
     ggtagcgccc tgacagccgg acctggatct ttgtttattg cctactgctt tatgggtttc       240
     gtcgtttgga ctgtcatgtg tggactgggt gaaatggctg cttggctacc attgtcctcc       300
     ggtttcactg gttacgctgg ccgtttctgt gaccctgctc tcggatttac cctcggatgg       360
     tgctactacc tcaaatatat cattctacca cctacacaac tcacggccgc tgctctagtc       420
     attacctatt ggccgagaac gtcagcagag aatgtcaatc caggtgtttg gattgccatc       480
     ttcatggtgg ctatcatcgt gataaactac ttcggcgtga agatcttcgg tgaattggag       540
     ttttggctct catctttcaa ggtgattgtc attctcggac tcattctgtg ctctttgatc       600
     ttcgcactcg gcggtggtcc agaccacgac aggagaggct tccgatactg gaataagccc       660
     ggcgccttcg ccactaaata tactgatggt gcccttggca aattccttgc tttctggtcg       720
     accatggtgc aagccacctt tgcattcctc ggtaccgaac ttattggtgt gaccgtcgga       780
     gaagcccaga acccccggaa gaccatcccc aaagctatca agctcacctt ctggcgaatc       840
     atcgtgttct atattctcag tgtactcttc ctcggtatgc tcgtccccta cgactccaag       900
     gaactggctt tcgcaaccga ggccgagagc tctgctgccg catcaccttt tgtggtggca       960
     atggggcaag tcgccgctct tcctcacatc atcaacggct gtatcctggt gttcgtgttt      1020
     tctgccgcca actctgatct atacattgcg actcgaactc tgtacggtct tgcccgtgag      1080
     aagaaggctc ctaaaatctt tgctcgcact aacagagctg gtgtcccaat ctattctctg      1140
     gcactgtcag cttctttctg cttgctcgcc tttatgagtg tgtccagtac ctccaaggaa      1200
     gtattcggat acttcaccga catggtgtca atcttcggat tgttgacatg ggtctccctc      1260
     ttgattaccc acatcttctt cattcgtgcg cgacgtgcac agggagtcga ccaggcaaca      1320
     ctggcctaca aagctcctct gggaatcatc ggttcctgca ttgcgctctt cttctgtgtt      1380
     ttggtgctct tcactcgcag cttcggcgtg tttatccacg acccggaaac atacggcaac      1440
     tttgactaca agacttttat cacttcatac atcggaatcc ccctctatgt tgccgcattc      1500
     gctgggtgga agatctggaa caagaccgag attatcaagc cccataatgc ggatatctgg      1560
     accggcaagg ccgaaattga ccgcgaagag gcggaatatg tggctatggt ggccattcag      1620
     gaccaaaact tgtctggctg gaacaaggtt tacaggaaga gtctcgcgtg gctcttctga      1680
//

If you have problems or comments...

PBIL Back to PBIL home page