(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE360

PENCW_16.PE360       Location/Qualifiers
FT   CDS_pept        join(825426..825549,825619..825639,825694..825731,
FT                   825784..828311,828366..828474)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000040280" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948883"
FT                   /orf_name="Pc20g03600"
FT                   /product="Pc20g03600 protein"
FT                   /function="ATP binding"
FT                   /function="formate-tetrahydrofolate ligase activity "
FT                   /function="methenyltetrahydrofolate cyclohydrolase activity"
FT                   /function="methylenetetrahydrofolate dehydrogenase (NADP+)
FT                   activity"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /biological_process="one-carbon metabolic process "
FT                   /protein_id="CAP85689.1"
FT                   /db_xref="GO:0004329"
FT                   /db_xref="GO:0004477"
FT                   /db_xref="GO:0004488"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="UniParc:UPI000183111F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF8"
FT                   /transl_table=1
FT                   /translation="MAAAKIDGTAIAKSIRQGLKSEIEQIQVNNPRFKPNLVIFQVGSR
FT                   SDSSTYVRMKLKAAQEANIICTLINVPESSTELELIQEITKANYDPAIHGILVQLPLPS
FT                   HMSEHAITSTVADEKDVDGFGAINIGELAKRGGRPLFTPCTPLAVMELLKASGVDPAGK
FT                   EAVVLGRSDIVGSPVSYLLKNADATVTVCHSKTPDIARVVKTADIVVAAIGQTELVKGD
FT                   WLKPGAVVIDVGINYKPDATKKSGERLVGDVDFESASQVASQITPVPGGVGPMTVAMLL
FT                   KNVVHSAKGYFEKQKDRHVTPLPLRLQTPVPSDIAISRAQYPKPITQIATEVGIAPHEL
FT                   EPYGHTKAKINLSVLDRLAHRRNGRYILVAGITPTPLGEGKSTTTLGLTQALGAHLNRI
FT                   SFANVRQPSQGPTFGIKGGAAGGGYSQVIPMDEFNLHLTGDIHAITAANNLLAAAIETR
FT                   MFHESTQKDAALYKRLVPASKGKREFKPIMFRRLKKLGIEKTNPDDLTEEEITRFARLD
FT                   IDPETITWRRVLDVNDRHLRGITVGQADTEKGLSRETGFDISVASECMAILALSNDLED
FT                   MRERLGRMVVATSRNGDPVTCDDIGAGGALAALMKDAIKPNMMQSLEGTPVMVHAGPFA
FT                   NISIGASSAIADKLALKLAGTEPDEDHEAKTGFVVTEAGFDFTMGGERFFNIKCRSSGL
FT                   VPDTVVIVATVRALKVHGGGPEIKPGAPLQEVYRTENVDVLRQGCVNLRKHIANAKQYG
FT                   VPVVVAINKFETDTDAEIAVIREEAIAAGAEDAVPANHWAEGGAGAVDLAKAVMTASSK
FT                   EKHFQLLYGLDGTIQERIERIGQAMYGAEKVEFSELAQKKVDTYTKQGFSNLPICIAKT
FT                   QYSLSHDPALKGAPTGFTVPIRDVRLAVGAGYLYALAADIQTIPGLPTAPGYLNVDIDT
FT                   ETGDIDGLF"
     atggctgccg ccaagattga tggcactgcc atcgcgaaga gcattcgcca gggcttgaag        60
     tccgagatcg agcagattca agtgaacaat cctagattca agccaaacct ggttatcttc       120
     caagtcggca gtcgatcgga ttctagtacc tatgtgcgca tgaagctgaa ggccgctcag       180
     gaggccaaca tcatctgcac cctgatcaac gttcctgaat cgagcaccga gctggagctc       240
     atccaagaga tcactaaagc caactatgac cccgcgatcc acggtatact cgttcaattg       300
     cccctcccaa gtcatatgtc tgagcatgca atcacgtcga ctgttgcaga tgagaaagat       360
     gtcgatggtt tcggcgcaat caatatcggc gagttggcta agcgaggcgg tcgcccgttg       420
     ttcactccgt gtacacctct ggcggttatg gaactactca aggcaagcgg cgtggacccc       480
     gccggcaagg aggcagtggt actgggacgc agtgacatcg tcggcagccc ggtcagctat       540
     ttgcttaaga acgccgatgc caccgttact gtctgccact caaagacacc ggatattgcc       600
     cgcgtcgtga agaccgctga catcgttgtg gcggccattg gccagaccga gcttgtgaag       660
     ggcgactggt tgaagcccgg tgctgtggtt attgatgttg gtatcaacta caagcctgat       720
     gcgactaaga agtccggtga gcgactggtc ggcgatgtgg acttcgagtc tgcttcccag       780
     gtagcctcac agatcactcc cgtccccggt ggtgttggtc ccatgacagt ggccatgttg       840
     ttgaagaacg tggttcattc cgccaagggc tactttgaga aacagaagga ccgccacgtt       900
     acccctcttc ctcttcgcct acaaacccct gtgccttccg acattgctat ctcgcgggct       960
     cagtacccca agcccatcac ccagattgcc actgaggtcg gtatcgcccc tcatgagttg      1020
     gagccctacg gccacaccaa ggccaagatt aacctgagcg tgctggaccg cctcgcccac      1080
     cgtcgcaatg gaagatacat cttggtcgcc ggtatcacac ccactcctct cggtgagggc      1140
     aagtccacca ccacattagg tctcactcaa gcactcggtg cccaccttaa ccgcatttcc      1200
     tttgcaaacg tccgacagcc cagccaaggc cctacattcg gcatcaaggg tggcgccgct      1260
     ggtggaggct acagtcaggt tattcctatg gacgagttca acctccacct gacaggtgac      1320
     atccacgcca tcaccgccgc gaacaacctt ctcgctgcgg ctattgagac tcgcatgttc      1380
     catgagtcca cccagaaaga tgcagctctc tacaagcgtc ttgtccctgc tagcaagggc      1440
     aagcgcgaat tcaagcccat catgttccga cgtctgaaga agctgggcat cgagaagact      1500
     aacccagacg atctcactga ggaggaaatt actcgttttg cccgccttga tatcgaccca      1560
     gagaccatca cttggcgccg cgttctcgat gtcaatgacc gtcacttgcg tggcatcact      1620
     gtcggccagg ctgacaccga gaagggcctg tcccgcgaga ctggcttcga catttccgtc      1680
     gctagtgagt gcatggctat ccttgccttg agtaacgact tggaagatat gcgtgagcgt      1740
     ctgggtcgta tggtggttgc cacttctaga aacggcgacc ccgtgacttg cgacgacatc      1800
     ggtgccggtg gtgccctcgc cgctttgatg aaggatgcca ttaagccaaa catgatgcag      1860
     agtttggagg gcacacctgt tatggtgcac gctggtccct ttgccaacat cagtattggc      1920
     gccagctccg ccatcgccga taagcttgcc ctgaagcttg ccggtaccga gcctgatgag      1980
     gatcatgaag ccaagaccgg tttcgtggtc actgaggctg gctttgactt cacaatgggt      2040
     ggtgagcgct tcttcaacat caagtgccgc tcctctggtc tggttccgga cactgtcgtc      2100
     attgtggcta ctgtccgtgc gctgaaggtt cacggcggtg gccccgaaat caagcccggt      2160
     gcccctctgc aggaggttta ccgcaccgag aatgtggatg ttctccgcca gggctgtgtt      2220
     aacctacgca agcacattgc caacgccaag cagtacggcg tcccggtggt ggtcgcgatt      2280
     aacaagttcg agactgatac cgacgccgaa attgctgtca tcagagagga ggcgatcgct      2340
     gctggtgctg aggatgccgt ccctgccaac cactgggctg agggtggagc cggcgccgtt      2400
     gatctggcca aggctgtcat gaccgccagc tccaaggaga agcacttcca gcttctctac      2460
     ggacttgatg gtactatcca ggagcgcatt gagcgcattg gccaggccat gtatggtgcc      2520
     gaaaaggtcg agttcagcga attggcccag aagaaggtgg acacctacac caagcaaggg      2580
     ttctctaact tgccgatctg tatcgccaag actcagtact cactcagcca tgacccagct      2640
     ctcaagggcg cccccaccgg cttcactgtg cccattcggg atgttagatt ggccgtgggc      2700
     gctggatacc tctacgcctt ggctgccgat attcagacca ttcccggact acccactgcc      2760
     cccggctacc ttaacgtcga catcgacacc gagactggtg atatcgacgg gctgttctag      2820
//

If you have problems or comments...

PBIL Back to PBIL home page