(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE362

PENCW_16.PE362       Location/Qualifiers
FT   CDS_pept        join(832471..832518,832606..832642,832705..832772,
FT                   832840..833222,833282..833349,833415..833932)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824640"
FT                   /orf_name="Pc20g03620"
FT                   /product="Pc20g03620 protein"
FT                   /protein_id="CAP85691.1"
FT                   /db_xref="UniParc:UPI0001831121"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGG0"
FT                   /transl_table=1
FT                   /translation="MVKAPGLDDLIISCALICDLAFYACIILERKYGIGIHSSKLSEYD
FT                   LQNQLFWLWLSVPFYNMTMIFAKLSALTLFARLFRPRPFLLATYIIMGALVIIGLWTTL
FT                   SGFFFCVPVNAFWDPSEDVRLANCLPAAPVWFTNAALQTSTDLVILVMPMPLLWKLQLP
FT                   KRQKWGILVVFSLGIFIIGTSSARLYPLSIMVGGGDFLEENAQAALWSSLEANVSIICI
FT                   SLPPLHPLLSRIFSFCFLPRPIQSRASKRRSSRTQMTEPLNRDGGIWCNELFTPGPASY
FT                   CTSISKVNTNEEDHENEEGIRVKRELRMQSDTLPTPDIEPHSANGVHLDMGEGAVAARS
FT                   HTAPENPRSNSSVERDFVDFEFPDYREKMNAPI"
     atggtgaagg ctcctgggct ggatgatttg atcatatcat gtgcattgat ctgcgatctg        60
     gctttttatg cctgtataat tcttgaacga aaatatggca ttggcatcca ctcaagcaaa       120
     ctttctgaat atgacctcca gaaccaacta ttttggttat ggctttcggt ccctttctac       180
     aacatgacca tgatctttgc caagctctcc gcccttacgc tcttcgcccg tctgttccgt       240
     ccccgtccct tcctcttagc tacctatatc atcatgggag ccctcgtcat cataggtcta       300
     tggacgacac tgagcggatt cttcttctgc gttcctgtca acgccttctg ggatccctcc       360
     gaagacgtcc gcctggcaaa ttgtctacct gccgcccctg tctggttcac taatgcggca       420
     ctccagacat ctactgatct ggtgatattg gttatgccca tgccgctatt gtggaagtta       480
     caactaccta aaaggcaaaa gtggggaata cttgtggttt tcagcctcgg aatctttatt       540
     attggcacca gctccgctcg cttgtatcca ttgagcatca tggttggcgg aggagacttt       600
     ctcgaggaaa atgcccaagc agccctctgg tcctccctag aggcaaacgt atccatcatc       660
     tgcatctccc tcccaccact ccacccactc ctctcccgca tcttctcatt ctgcttcctc       720
     ccgcgaccga tacaatctag agcctcaaag cgtcgctcca gtagaacgca gatgaccgag       780
     cctctcaacc gtgatggcgg gatctggtgc aacgaactct tcactcccgg accggcgagc       840
     tactgcacta gtatttccaa ggtcaatacg aatgaagaag accacgagaa tgaggagggg       900
     atccgtgtta aacgggagtt gaggatgcag tccgacactc ttcctacccc tgatatcgaa       960
     cctcattctg cgaatggtgt ccacctagat atgggggagg gggcggtggc agcgaggagt      1020
     cataccgcgc ctgagaatcc tcgctcgaat tctagtgttg agagggattt cgtggatttc      1080
     gagtttccgg actacaggga gaaaatgaat gctcctattt ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page