(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE363

PENCW_16.PE363       Location/Qualifiers
FT   CDS_pept        join(complement(835775..836204),complement(835327..835663),
FT                   complement(834970..835241),complement(834731..834906),
FT                   complement(834399..834681),complement(834204..834343))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158126" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671928"
FT                   /orf_name="Pc20g03630"
FT                   /product="Pc20g03630 protein"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="CAP85692.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR015830"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI0001831122"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS6"
FT                   /transl_table=1
FT                   /translation="MATSYQDRCAQKRADQLSLIPPEWRLDPVPSIESAPNALAYLRRI
FT                   LSPEELALTEETDIAVLLRKLSSGELSSLKLTRVFAKRAALAHQLTACCTEIFFEQAFA
FT                   VAQGLDDYLAKTGKTVGPLHGLPVSIKDLFSVEGVDTSIGWVGLTNNPAKADKSVARML
FT                   RRLGAVLYVKTNLPQSMMMSDSYNHVFGQCVNPFNRELISGGSSGGEGSLVAGRGSVLG
FT                   IGTDLGGSIRIPAALCGLYGLSPSPGRHPYERGNPGQDIVRSVAGPMACNLATIERYME
FT                   VLPEARPWEVDQHVAPVGWRKELASPGAKRLRIGFLVDDGVVKVQPPIARAMREVIEAL
FT                   KAAGHDVFEWDASSHSYAYELWAKAIFSDGGEGCRRQIEKTGEPLIEGMLVGKPEDTLT
FT                   TSQTHQLNADKYNFESAYLDRWVSSDIDALIMPNTAWVGYKPWTWVKSSAYVGYTSIWN
FT                   FLGYAALAVPVTTASRTKDVPDKEWLAHVPRNDSDRFNKQQYDVNLVEGMPVGIQVVGG
FT                   RFGEEKCVAVAKAIEQAMQGKITSRARL"
     atggctacct cgtaccaaga ccgttgcgct caaaagcgcg ccgaccagct ttccctcata        60
     ccccccgaat ggcgcttaga tcccgttccc tccattgaat cagctccaaa tgctttggcc       120
     tatctccgcc gcatccttag tccagaggaa ctggccctca cggaagaaac tgatatcgcc       180
     gtccttcttc gcaagctttc atccggagaa ctctcgtctc taaagctgac tagagtcttc       240
     gctaaacgtg ccgccctcgc ccaccaactt acagcatgct gtacagagat cttcttcgag       300
     caggcctttg ccgtcgccca gggactagac gattacctcg ctaagacagg gaagactgtc       360
     ggccctctac atggattacc agtatccatc aaagacctat tctccgttga aggagtagac       420
     acttcgatcg gctgggtcgg cctcaccaac aacccagcga aggcagacaa atccgtagcg       480
     cgcatgctcc gccgtctcgg cgctgtcctc tacgtgaaga ccaatctgcc acaatcaatg       540
     atgatgtccg actcgtacaa tcacgtcttc gggcagtgcg tcaacccatt caaccgagaa       600
     ctgatttccg gtgggagttc tggcggcgag ggctcgcttg ttgcggggcg tggaagtgtt       660
     cttggtattg gtaccgatct gggtggttcg attcgtattc cggctgcgct ttgtggactt       720
     tatgggttgt cgcctagtcc ggggagacat ccgtatgaga gggggaatcc tgggcaagat       780
     atcgtgagat cggttgctgg gcctatggcc tgtaatctcg cgactattga gaggtatatg       840
     gaagttctgc cggaggcgag gccttgggag gttgatcagc atgttgcgcc tgttgggtgg       900
     aggaaggaat tggcttctcc tggtgcgaag aggttgagga ttggattttt ggttgatgat       960
     ggtgttgtca aggttcagcc gccgattgcg agggccatgc gcgaggttat tgaggcgctg      1020
     aaagcggcgg gacatgatgt gtttgagtgg gatgcctcct cgcatagtta tgcatatgag      1080
     ctctgggcaa aggctatctt ttctgatggc ggcgagggct gtcgaagaca gatagagaaa      1140
     accggcgagc cgcttattga gggtatgctc gttggtaaac ctgaggatac tttgactacc      1200
     agtcaaacgc accaactcaa tgcggacaaa tacaatttcg aatcggcata tctcgataga      1260
     tgggtatcat ccgatattga cgcactgatc atgcccaata ctgcatgggt gggatacaaa      1320
     ccgtggacgt gggtgaagtc cagtgcatat gtgggctaca ccagtatctg gaatttcctt      1380
     ggctatgccg cgttagcagt ccctgtgacg accgcctcga ggacgaagga tgttccggat      1440
     aaagagtggc tcgcccatgt cccgaggaat gatagtgata ggtttaataa gcagcagtat      1500
     gatgttaacc tggtggaggg gatgcctgtg gggatacagg ttgttggggg tcggtttggc      1560
     gaagagaagt gtgttgctgt ggccaaggcg attgaacagg ctatgcaggg gaagattacc      1620
     tcgcgggcaa gactttga                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page