(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE365

PENCW_16.PE365       Location/Qualifiers
FT   CDS_pept        join(complement(838224..839439),complement(837959..838089))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948886"
FT                   /orf_name="Pc20g03650"
FT                   /product="Pc20g03650 protein"
FT                   /protein_id="CAP85694.1"
FT                   /db_xref="UniParc:UPI00018311F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS8"
FT                   /transl_table=1
FT                   /translation="MQYPTPVPVFVQTSHPPPPTFLARPRPKFCILRPGGFWTPLIPLD
FT                   ELPSWLEICNWAPDMYMGMYPASMTFMPREGEYDVVCHHCSHGVDSLHQSVSEREASSV
FT                   TASNAASSKDCHEQHASPNAQHHDTVSLPAVLHRDSPNHFLEQPPFSAILQTPFVGMCV
FT                   VDVNSQYPDIAPDQAGPKRRMSLENSIPPQVFGAVGVGSPPLSVANSANARRPDTPYPH
FT                   AHGPGSFAKPQRVASLQNESVASMKSGSVASTRSLTVAAIEQMKRMRRRRLSRGSSLHA
FT                   SISVPEAKSLSQVSDSKISKVSKVSKNSKISKLSRISRVSGVSKISSIRVISKHSPKVV
FT                   LRRRRAEERKARKSAQAVTSMEKPEQVNSATKRRDRRERMMQRRRQSDRGKQPYANMMR
FT                   IPNWSPDRCLSFILFMLGLAMSSVIPDCPFLRLVILLFSADVRLVIVSR"
     atgcagtatc ctaccccagt tccggtcttc gtccaaactt ctcatccacc ccctcctacc        60
     tttcttgccc ggccacggcc aaaattttgc attctgcgcc ccggagggtt ttggacacct       120
     ctgattccac ttgacgagtt gccttcttgg ttggagattt gcaactgggc ccctgacatg       180
     tatatgggaa tgtacccggc gtcaatgacc ttcatgccac gagaagggga gtatgatgtt       240
     gtctgccatc actgctcgca tggcgtggac tcgctgcacc agagcgtctc tgaacgagaa       300
     gcttcttctg tgacagccag taatgccgcc tcgtccaaag actgtcatga acaacacgcc       360
     tcgccaaatg cccaacacca tgatactgtg tccttgcctg cggtgctcca tcgcgactcc       420
     ccaaaccact tcttggagca gccccctttc agtgcaatcc tccagacacc ttttgtcgga       480
     atgtgtgtgg tcgacgtgaa ttcgcagtat ccggatatag ccccagacca ggctggcccg       540
     aaacgacgta tgagcctcga gaactcgatt cctcctcagg tctttggtgc agtcggagtt       600
     ggcagtcctc cgctttccgt ggccaactct gcgaacgctc gaaggcccga taccccttac       660
     ccacatgcac atggccctgg atcgtttgcc aagccccagc gcgttgcatc cttgcaaaac       720
     gaaagcgttg catcaatgaa aagtggaagc gttgcgtcta ctcgatctct gacggttgct       780
     gctatcgagc aaatgaagag aatgcgaaga agaaggctct cgcgtggaag cagtctgcat       840
     gcaagcatca gtgtcccaga ggcaaagagt ctgtctcagg tatcagactc aaagatttca       900
     aaggtttcga aagtttccaa gaattccaaa atttccaagc tttccaggat ctccagggtc       960
     tccggggttt ccaagatttc ctccatccgg gtcatttcaa agcatagtcc gaaggttgta      1020
     ctgcgtcgtc gacgcgcgga agaaaggaag gcccgcaaat cagcacaggc agtgacctca      1080
     atggagaagc cagagcaagt gaattcggct accaagagac gcgatcgacg tgagcgtatg      1140
     atgcaacgca gaaggcaatc tgaccgtggc aagcagccat atgcaaacat gatgcggatc      1200
     cccaattgga gcccggatag atgtctttcc ttcattttgt ttatgctggg tctggctatg      1260
     tcttcggtca ttccagattg cccttttttg cgtttggtca tcttgttgtt ctcagctgac      1320
     gtccggctgg tgatcgtctc tcgttga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page