(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE367

PENCW_16.PE367       Location/Qualifiers
FT   CDS_pept        join(complement(843101..843368),complement(842917..842977),
FT                   complement(842611..842854),complement(842280..842508),
FT                   complement(842064..842209))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000187520" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128992"
FT                   /orf_name="Pc20g03670"
FT                   /product="Pc20g03670 protein"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85696.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="UniParc:UPI00018311FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT0"
FT                   /transl_table=1
FT                   /translation="MASFLPQTHEQPRPLEGQNGGIRRRFQVESTPFAGRIGANQEFSV
FT                   SPLEEAELLRKTPDAAPLVPWSQMICPNQFIQLNIWKAAFVEGVVTCLLVYFTCFLAVG
FT                   LGKMAGHLATGPVVPSLIGGLLNTLTLPLFIFAAGPVSGGHVNPTITMATFFARLSTFP
FT                   RSILYISFQLLGATVAGYLLRGSFDTRSFVIPGCVIDTSVVSVGSAFTIEVTTDFMLIF
FT                   LSFSVGLDPRQREVFGPALGPVFVGIILGITSFGTGYSQVGYTGFGGNPARCFGAMVGS
FT                   HFTSYHWIHWLGPIVASILHGIMYYFIPPYQYCV"
     atggcctcat ttctccctca gacacatgaa caaccgcgac cattggaagg tcaaaatggc        60
     gggatacgcc gtcgattcca agttgaaagt acaccgtttg ccggtcgaat tggagctaat       120
     caagagtttt ccgtctctcc tctggaggag gcagagttgt tacggaagac tcccgatgcc       180
     gcaccgctgg tcccttggag ccaaatgata tgcccgaacc agtttattca gcttaatata       240
     tggaaagctg catttgttga aggtgttgta acatgcttgc ttgtatactt cacatgtttc       300
     ttggccgttg gtctaggcaa aatggctgga catcttgcta cagggccagt ggtcccaagc       360
     ctgataggag gtctgctcaa tactctgacc cttcctctat tcattttcgc agcgggccct       420
     gtgtccggcg gtcatgtgaa ccctacaatc actatggcga cattcttcgc caggttatct       480
     accttcccgc gaagcattct ttatattagt tttcagttgc tcggagctac tgttgctggc       540
     tatctactga ggggtagctt tgacacccga tcttttgtca tccccggatg tgtcatagac       600
     acttctgtag tgtcagtagg aagcgcattt accatcgaag ttaccaccga tttcatgctc       660
     atattcctgt cattcagcgt gggcctcgat ccacgccaaa gagaagtgtt tggtccagct       720
     cttggtcctg tctttgttgg tattattctc ggaatcacaa gctttgggac tggctatagc       780
     caagtcggat acactggctt cggtgggaac cctgcgaggt gtttcggtgc tatggtcggc       840
     tcacatttta cctcgtatca ttggattcac tggctaggcc ctattgtggc ttcaatcctt       900
     cacggtatca tgtattattt tatcccgccg taccaatatt gtgtatga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page