(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE369

PENCW_16.PE369       Location/Qualifiers
FT   CDS_pept        complement(845718..846896)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195760" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671929"
FT                   /orf_name="Pc20g03690"
FT                   /product="Pc20g03690 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85698.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00018311FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT2"
FT                   /transl_table=1
FT                   /translation="MANPPVQLSLQTTQGKSPSTQVPSSLTPPVTPIAKERPPRSTPSP
FT                   IQDPKAAQTPSTSKDNVGTLQFTDDLEICHDENNRSLEFGRGVWSIVYKARSFPHPQTN
FT                   PPGTPPSSPTSRSQVLAVKAPLRRDARPVLNAEASTLTRLTFTQGHEQYIVPFHGYHAP
FT                   LGALVMSAIPTSLASYIEDQSKQARTHHTTATMFDPVQGPASYQDLARRLITGLNWLHQ
FT                   VAAVVHGDIKPHNILLRPIDTDDCVEAPAFPFQPLYADFSATVDIPVHAEARDTTRASM
FT                   SSFTPPFTAPEMLASLTSTEMAPTPASDVFSLAATLLAIATGDLLLYPNMNHRLRLEMA
FT                   RAGHQIVDFARSGVSGSRVPRNGFVERIVKPAVVKDPAMRITTPEWVQLASC"
     atggccaacc caccagtaca attgtcgctc cagacaaccc agggcaaaag cccatctact        60
     caagtcccgt cgagtctcac gccaccagtg actccgatag ccaaagaaag gcccccaaga       120
     tcaactccaa gtccaattca agacccaaag gcagcacaaa cgccatccac ctccaaggac       180
     aatgtcggca ctctgcagtt caccgacgac ctcgagatct gccacgacga gaacaaccgc       240
     tccctcgagt tcggccgcgg cgtctggagc atagtataca aagcgcgctc attcccacac       300
     ccgcaaacaa accccccagg cacgccccca agctccccaa cctcaagatc gcaagtacta       360
     gccgtgaaag cacccttgcg ccgcgatgcg cgcccagtcc taaacgccga agcatcaacc       420
     ctaacccgcc tcacattcac ccaaggccac gaacaataca tcgtcccctt ccacggctac       480
     cacgcccccc taggcgcact agtaatgtcc gccatcccaa cctcactagc atcctacatc       540
     gaagaccaat ccaaacaagc acgcacccac cacacaacag caacaatgtt cgacccagtc       600
     caaggcccag cctcatacca agacctcgcg cgcagactaa tcaccggcct gaactggctg       660
     caccaagtcg ccgccgtcgt gcacggcgat ataaaaccac acaacatcct cctccgccca       720
     atcgacacag acgactgcgt cgaagcccct gctttccctt tccagcctct gtatgccgat       780
     ttctccgcta cggtggatat ccccgtccac gcggaggcgc gcgatacgac gcgcgcgtcg       840
     atgtcgtcgt tcacgccgcc gttcacggcg ccggagatgc tggcttcgct tacgtcgacg       900
     gagatggcgc cgacgccggc gtcggatgtc ttctcgcttg cggctacgct gcttgctatt       960
     gcgacggggg atttgctgct ttatccgaat atgaatcatc ggttgaggct ggagatggcg      1020
     agggctgggc atcagattgt tgattttgcg aggtctgggg tgagtgggag tcgggttccg      1080
     aggaatgggt ttgttgagcg cattgttaag ccggctgttg ttaaggatcc ggcgatgcgc      1140
     attaccacgc cggagtgggt tcagcttgcg tcttgttga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page