(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE37

PENCW_16.PE37        Location/Qualifiers
FT   CDS_pept        join(complement(87826..87836),complement(87539..87655),
FT                   complement(87407..87476),complement(87183..87345),
FT                   complement(87131..87150))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824086"
FT                   /orf_name="Pc20g00370"
FT                   /product="Putative uncharacterized protein Pc20g00370 "
FT                   /protein_id="CAP85366.1"
FT                   /db_xref="UniParc:UPI00018319DD"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD4"
FT                   /transl_table=1
FT                   /translation="MTQNLIMILTTLLNNTNVYISVHMVNIPLSVVSLSCPTGLSSIAI
FT                   YLGNYLGTRGHDNIIWNRRREISPSSRDYDKEVLAGHKPREGGFGVWGFNSYKIHSPRE
FT                   AAKSLHSIFERELPIQHFLRTL"
     atgactcaga acttaattat gatactaacc accctactaa acaataccaa tgtctatata        60
     tcggtccaca tggtcaatat tcctttatca gtggtctcgc tatcatgtcc cacaggctta       120
     tcttccatag cgatctacct aggtaattac ctaggtaccc gtggacatga taatataatc       180
     tggaaccgaa gacgggaaat atcaccaagc tcccgtgact atgataagga ggtcttggct       240
     gggcataagc cccgagaagg tggatttgga gtctggggtt ttaattcgta taagatccac       300
     agtcccagag aggcggctaa gagtctccat agtatatttg agcgggaatt gccaatacaa       360
     cactttttga gaactctctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page