(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE370

PENCW_16.PE370       Location/Qualifiers
FT   CDS_pept        complement(847788..849698)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195771" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977861"
FT                   /orf_name="Pc20g03700"
FT                   /product="Pc20g03700 protein"
FT                   /function="rRNA (adenine-N6,N6-)-dimethyltransferase
FT                   activity"
FT                   /protein_id="CAP85699.1"
FT                   /db_xref="GO:0000179"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="UniParc:UPI00018311FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT3"
FT                   /transl_table=1
FT                   /translation="MPKIATARTPLARFPLTKKLHPLISRQVGKNRARTQYVSEGLIGK
FT                   SRDPNLIMATNLLLDPADNVLERVSPYLRRNQPLDILDLWPGGGLISSKVNELLQPRRH
FT                   VLVEPDPRFNDFLQPLAQSNPCYKLVDEPIYGKFDWSYFFATHLPEQGRGNQENSAIIP
FT                   KNDSLLILANLPAARSGMDHFKPSRWFLNYMKNCLKQKDVNLYGAVRVLATMPSSEVSD
FT                   MLPRSAMERTRTGVFAETIGLHNIEVASPAEEERSHQWRGWNDLNKTRERVAETAAANN
FT                   IITPPTRELPPLEVVPHVPYRTSRVERPYQPRVLTQMHKKQLMDIAEADKLGLDSCSDT
FT                   TDPKAKAIIRKRALAWTKLARDNSATYFRQQLVDVILEQDQVGWTFARAAADPEESVES
FT                   LKAIEDRMVSLKSSYATLKSSIHHTMLEKHQHAIDDVRLGRLANHFVDVGLTHEQRPYE
FT                   PLYIHPDETYPRGDGRAVIYFEPDSNPPSLKKTFDLPSTTVQLVLDRYLAMLAVVGTRG
FT                   TMPVAEFLKTLFPTESINSHVRDIPSLASFAERRLKPGRGPMPLPEGSTSDPAFTYQDN
FT                   VDYDLSDVRLRTLSAATLLDIAVKYEKLPEKLGIIAFSRALGGTMTQAQIGEELLNMRL
FT                   R"
     atgccaaaaa tcgccacagc tcgaacgccg ctggcgcggt ttccgttgac gaagaagctt        60
     cacccattga tatccagaca ggtcgggaaa aacagggctc gaacacagta cgtgagtgaa       120
     ggcctaatag gtaagtctcg agatccgaat ctgataatgg ctacaaactt acttttggac       180
     ccggcagata atgtcctcga gcgcgtatcg ccctacctcc gccgaaacca accgctagac       240
     attctggacc tttggcctgg gggtggtctc atatcatcta aagtgaatga acttcttcag       300
     ccacgccgcc atgtcctcgt tgaaccagat cctcgtttca acgatttcct tcaaccgctc       360
     gcccagagca acccgtgtta taagctcgtc gatgaaccca tatatgggaa atttgattgg       420
     tcttacttct tcgcaactca tcttccagaa caaggccgtg ggaaccaaga gaactcagct       480
     attataccaa agaatgattc ccttctcatc ctcgctaatt tgcctgctgc tagaagtgga       540
     atggatcatt tcaagcccag ccgctggttt ctcaactaca tgaagaactg cttaaaacag       600
     aaagatgtga acttgtacgg ggccgttcga gtccttgcta caatgccctc cagcgaagtc       660
     tcggatatgt taccgcggtc cgctatggaa cgcacacgaa ctggcgtatt cgcggagacc       720
     ataggcttgc acaacataga ggtcgccagt cccgctgaag aggaacggtc ccatcaatgg       780
     cggggctgga atgacttgaa caagaccagg gagcgtgtgg ctgaaacagc cgcagcaaat       840
     aacattatca ctccacccac cagagagctt cctcctttgg aagtggtacc acacgttccc       900
     taccgaactt cgagagttga gcgaccgtat caacctcgag tgcttactca aatgcacaag       960
     aagcagttga tggatatcgc agaagcagat aagctgggtc ttgattcgtg cagcgatacc      1020
     acagacccca aagccaaagc aataattcga aagcgagcat tagcatggac aaagcttgcc      1080
     agggacaact cagcgaccta cttccgccaa cagcttgtcg acgtaatact tgagcaggac      1140
     caagtgggct ggacatttgc acgtgcggct gcggatcccg aggagagtgt tgagagtctg      1200
     aaggctatag aagatcgtat ggtatcgctc aagtcgagtt atgccacttt aaaatcgagc      1260
     attcaccaca cgatgttaga aaaacatcaa catgcaatcg atgatgtccg cttgggcaga      1320
     ctcgccaacc atttcgttga tgtcggcctg acacatgagc aacgaccata tgaaccccta      1380
     tacatccatc ccgatgagac ttatcctcgc ggggacgggc gcgcagtcat atatttcgaa      1440
     ccagattcca acccgcccag tctgaagaag acgtttgacc taccaagcac aacggtacaa      1500
     ctcgtcctcg accggtatct tgcaatgcta gccgtggtgg ggactcgtgg cacgatgcca      1560
     gtcgccgaat tcttgaaaac acttttccca accgagagta tcaatagtca tgtgcgagat      1620
     attccaagcc ttgccagctt tgccgagagg cggctcaagc ctgggcgtgg gccaatgccc      1680
     ttgccggagg gttcgacgtc cgaccctgct ttcacctacc aggataacgt ggactatgat      1740
     ttgagcgatg ttcgactccg cactctttcc gcggcaaccc tgttggatat tgcggtcaag      1800
     tacgagaagc taccggagaa gctcggtata atcgccttca gccgagctct aggcgggaca      1860
     atgacccagg cccagatagg cgaagagtta cttaacatga ggctcagata g               1911
//

If you have problems or comments...

PBIL Back to PBIL home page