(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE371

PENCW_16.PE371       Location/Qualifiers
FT   CDS_pept        join(850049..850195,850276..851769)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195792" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977862"
FT                   /orf_name="Pc20g03710"
FT                   /product="Pc20g03710 protein"
FT                   /protein_id="CAP85700.1"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI00018311FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT4"
FT                   /transl_table=1
FT                   /translation="MPSNATGGATGATAPQSVENITRIAQNYEYNSSVPLRYWLRTATT
FT                   LLREARIYEREGHDEQAYLILFRHAQLILVHLSKHPDTKKNEEDRKALVAAEKEVEKNL
FT                   SKLEILRPRINKRYERYTQLMRERESRKQPSRTKIVAEPREQVADPALAGVAEPLEAGE
FT                   NRDLAVQLAQSELNRRATVRDSKSLSGPSAEELETRRAAGVWGDWDHSIKSESRAGDRD
FT                   LGQRVQDISSKPDHTDGPYGQRAKEPVVPSSATSTYNYPTVPRQRPLEPAVSPGNIAIL
FT                   DKNVERQAPPILPPKEHLEPSRASIVNDSATDLAPARPAKVLPGPALPEKIRPSEQATA
FT                   TRSDLDPSSYTFKPSAYLENGTPLRSVFLPANLRSRFLSLVAPNTRANLETCGILCGTL
FT                   VSNALFISKLVIPEQTSTSDTCETVNESALFDYCDSEDLMTLGWIHTHPSQTCFMSSRD
FT                   LHTHCGYQVMLPESIAIVCAPSKSPDWGVFRLTDPPGLKSVLNCHQTGLFHPHAEENIY
FT                   TGALRPGHVFEVSGLEFETVDLRPGSLKN"
     atgccttcca atgcgacggg cggtgccact ggagctactg cccctcagag cgttgagaat        60
     atcacgcgga tagcacagaa ctacgagtac aactcctctg ttccattgcg gtattggctc       120
     aggaccgcca caacgctttt acgcgaggcc cgtatatatg aacgcgaagg acacgatgag       180
     caagcctatc tcattctatt tcgacacgct cagttgatcc tggtccatct gtctaagcac       240
     cccgatacca aaaagaacga ggaagatcgc aaggctttgg tggcagccga gaaagaggtt       300
     gagaaaaacc ttagcaagct ggagattctg aggccgcgta tcaataagcg atatgagcgt       360
     tacactcagt tgatgcggga gcgcgaatct cgcaagcagc cctcccgaac caagatcgtc       420
     gccgaaccac gagaacaagt cgccgatccc gctcttgccg gcgtggcaga gcctttggaa       480
     gctggggaga atcgagatct cgccgtgcag ttagctcaat cagagctcaa ccgccgagcc       540
     acagtccgag actcaaagag tctttctggg ccatctgccg aagagctgga aactcgtcgc       600
     gcagctggtg tatggggtga ctgggaccat tctatcaaat cggaatcccg cgcgggtgat       660
     cgcgacctcg gtcagcgcgt tcaggatatt agctccaagc ccgatcatac agatggacct       720
     tatggtcaac gtgcgaaaga gcccgtggtc ccttcgtccg ctacttctac gtacaattat       780
     ccaactgtgc cacgtcagag gccgttggag cccgctgtgt ctccaggcaa tattgccatc       840
     ctcgataaga acgtcgaacg ccaggcacct ccgatattgc ctccgaagga gcaccttgag       900
     cctagccggg catctatcgt caatgattct gcaacagatt tagcgccagc gcggccagct       960
     aaagtattgc caggtccggc gctgcctgag aagatccgac cttccgaaca agcaaccgct      1020
     acgcgctcag atctcgatcc ctcgagttac accttcaaac cctccgccta tctcgaaaat      1080
     ggcacccccc tgcgctcggt atttttacca gcgaacctac gatcccgctt cttatctctg      1140
     gttgctccta acacccgcgc caaccttgag acatgcggta ttctgtgtgg tacccttgtc      1200
     tccaacgcgc tcttcatatc caagctggtc atccccgagc agacatcgac atcagacacc      1260
     tgcgaaacgg ttaacgaatc cgctcttttt gactactgtg actcggagga tttgatgaca      1320
     ctcggctgga tccacacaca tccgtcacag acttgtttca tgagctcccg tgatctacac      1380
     acgcactgcg gttaccaagt gatgctgcca gagagtattg ccatcgtgtg cgctccgagt      1440
     aaaagtcccg actggggtgt gttccgactg actgatcctc cgggtctaaa gtcggttttg      1500
     aactgccacc agacgggtct gttccaccca catgccgagg agaatatcta cacgggggcc      1560
     ttgcggccgg gacatgtctt cgaagtcagt gggttggaat ttgagacggt ggaccttcgt      1620
     ccgggttcgt tgaagaacta a                                                1641
//

If you have problems or comments...

PBIL Back to PBIL home page