(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE372

PENCW_16.PE372       Location/Qualifiers
FT   CDS_pept        join(852281..853272,853328..853472)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948889"
FT                   /orf_name="Pc20g03720"
FT                   /product="Pc20g03720 protein"
FT                   /protein_id="CAP85701.1"
FT                   /db_xref="InterPro:IPR006571"
FT                   /db_xref="UniParc:UPI0001831200"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT5"
FT                   /transl_table=1
FT                   /translation="MSSTSENIPSDTPTSSTSTGSASQPTEKPPYQSASYFSYPVTHVV
FT                   SGLYRRITDPDLAKEMPSVMPWSRSSSSSEVFTPRRTASPFQPPPLTPLTLEIPTGADL
FT                   LQQRLLTRALAEEIRLLVPPRLQLAETWRLAYSLDRDGASLSTLYENCAQFSHRSPRAG
FT                   YVLVIRDSSPSSSVFGAYMTDAPHPDSQFYGTGECFLWRASVLPPPASFPLVLPGEGPQ
FT                   SEEALERAGLPPPPSADTTTAGRWSTLRNDKSKPPRAESPAHNLNMNIKTNLAAASGGV
FT                   LAPPSPSSIHTPSRSGASTPERIRFKAFPYSGVNDYMIFCETGFLSLGGGDGHYGLWLD
FT                   SSLEKGVSASCQTFGNEPLSDEGVKFDVLGVEVWYVGS"
     atgtcgtcca cgtcagaaaa tatcccctcc gacaccccca cctcctccac ctccacggga        60
     tcagcatccc agcccaccga aaaaccaccc taccaatccg cctcctactt ctcctaccca       120
     gtcacccacg ttgtctcagg actctaccgc cgcataacag accccgacct agccaaagaa       180
     atgccctccg tcatgccatg gtcacggtcc tcctcctcat ccgaagtctt cacaccgcgc       240
     cgaacagcct cacccttcca accaccaccg ctcacacccc tcactctcga aatccctaca       300
     ggagcagacc tcctccagca gcgactcctg acacgcgccc tggcagaaga aatccgactc       360
     ctagtgccac cccgcctcca acttgccgaa acctggcgtc tagcctacag cctggaccgc       420
     gacggcgcct ccctctccac cctctacgag aactgcgccc agttctcgca ccgcagcccg       480
     cgggcgggct acgtcctcgt aatccgcgac tcctcccctt ccagctccgt cttcggcgcc       540
     tacatgacag acgccccaca cccggactcg caattctacg gcacgggcga gtgcttcctc       600
     tggcgcgcaa gcgtgctccc acccccggca agcttccccc tcgtcctacc aggcgaagga       660
     ccacagtccg aggaagccct tgagcgcgct ggcctccctc ctcccccctc cgccgatacc       720
     actaccgccg ggcgctggag taccctgcgc aacgacaagt cgaaaccccc gcgcgcggaa       780
     tccccggctc acaatctcaa tatgaatatt aaaaccaatc tcgcggctgc gagtggtgga       840
     gtcctggcgc ctccatcgcc ttcctccatt catacccctt cgcggagtgg tgcgagcacc       900
     cccgagcgca ttcgcttcaa ggctttcccg tacagtgggg ttaatgatta tatgatcttc       960
     tgtgaaactg gatttctcag tctaggaggc ggtgacggtc actacggatt gtggcttgac      1020
     agcagtcttg aaaaaggtgt cagtgcatcc tgccagacct ttggcaacga gcctctctcg      1080
     gatgaaggcg ttaagttcga tgttcttggg gtggaggtgt ggtatgttgg ttcttga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page