(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE373

PENCW_16.PE373       Location/Qualifiers
FT   CDS_pept        join(complement(855209..857125),complement(854456..855142))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000180546" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824641"
FT                   /orf_name="Pc20g03730"
FT                   /product="Pc20g03730 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAP85702.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="UniParc:UPI0001831201"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT6"
FT                   /transl_table=1
FT                   /translation="MAGSAEFGGPPRQLRPDQVPLLLNTIDKLRSIGVGEHVELPQMII
FT                   CGSKANAKRSVIESISRIRFPVRKDFHNGFVTEITLRRHATTRFQVSVEPGPSSSKSQL
FT                   DIQELKGSMVTAPNAEQSVSLIEKATGFVKPSLEDGFSEDVMRVELSGPDQPNLTLIDI
FT                   PRLYFTEGIDDENKDKCAGHLQIEKYVRNPRTIILAVVSAKIDICAQKINDFADKYDRG
FT                   RSRILGIITHLDTLEESSDEEKLWQMAVKEEISQQPLGLHLVWTRSSESRDVPDEQRDQ
FT                   KEKEFLERGDWKTVPRESVGTDNLRSRLSTLFVNHVQSSLPRLISEINQRTRKIQSNMS
FT                   KLRTPRETIHQQKALLVNLGSDFHRITSQALTGMYIDDFFDTRVDDDQPTTRDPRRLRA
FT                   MIRALNEDFADVMDIAGCRQFIHGVNNQVTSLLNPCNPYANIRQPVHKSRMEFELDVLE
FT                   IMCRDRGLEFPGNINQLVLANLFRDQSEPWADIARAHVKKSWETIREFVSLLMDHLADE
FT                   HMSAVIIRTVIQPQLDRMHASLLGKVLELTAANKRGHALPLSRSFLRGHPLPLDRSFLA
FT                   RMQKSRNDRVLAHLQQSLPSSLPSNFSTTYNMGEIRAATQSMESSSNPFVASDLIDQFQ
FT                   AYYNNALGVFTDNITTLGIENCLLDPLNDLLTTRKITEMEDSQIEDLFAGVQNGVEDQG
FT                   HDPGDELKLLQTAVRVLDQFKIAPSTGAIKSPGLSSAHGRSSLQPYLIPQGIICNGASA
FT                   NPFGVLCVDSRVQGQNNTPRYQISWPYSQAPDMQNSTTPCPSGPFGLNPGTMNPGTVSV
FT                   PSVSAPTVNAAPTSGVPGFAGPTPPLPQTVTSSPFCSLRAGPDLFGTPDTSSHDA"
     atggctggtt cagccgagtt tggcgggcct ccccgtcagc tgcggccaga ccaagttccc        60
     ctgctcctta acaccatcga caaactccga agcattggtg ttggcgagca tgttgaattg       120
     ccacagatga ttatctgcgg ttccaaggcc aacgccaagc gctctgttat cgagtcaatc       180
     tctcgcatac gcttcccagt caggaaggac tttcacaatg gcttcgttac tgagatcacc       240
     ttacgccgcc atgcaactac tcgcttccaa gtcagcgttg aacctggtcc atcatcgagc       300
     aaaagccagt tagatatcca ggaactcaaa ggatccatgg tcaccgcccc caatgctgag       360
     cagtcagtat cactgattga gaaagctact ggattcgtca aaccctctct cgaagacgga       420
     ttcagtgaag atgtcatgag agtggagctt tctggccccg atcaaccgaa cctgactctc       480
     atcgatattc ccaggcttta cttcacagaa ggcatagatg acgaaaacaa ggacaagtgt       540
     gctggtcatc ttcaaattga gaaatacgtg cggaatccac gtaccatcat cctcgctgtg       600
     gtatccgcaa aaatcgacat ttgtgctcaa aagataaacg atttcgcgga caagtatgat       660
     cgaggacgaa gccggatctt gggaatcatc acccatctcg acacacttga ggaatcgtcc       720
     gacgaggaaa agctatggca gatggccgtc aaagaagaaa tatcccaaca gccgctgggc       780
     ttgcatttgg tgtggacgcg atcatccgag agccgtgatg tgccagacga acagagagat       840
     cagaaggaga aagagttcct cgagcgagga gactggaaaa ccgtgccacg agagtccgtt       900
     ggtacagaca acctacgcag tcgactcagt accctttttg tgaatcacgt tcagagcagc       960
     ctccccagac tgatttctga aatcaaccaa aggactcgga agatccaatc gaatatgtct      1020
     aagctgcgca ctccccgcga gacgatccat caacagaagg cattgcttgt caacttgggt      1080
     agcgatttcc accgcataac ctcgcaagca ttgactggca tgtacattga cgacttcttt      1140
     gatacccgag tggatgatga tcaacccacg acccgtgacc ctcgacgtct gcgtgctatg      1200
     atccgtgcat tgaacgagga tttcgcagat gttatggata ttgccggttg tcgtcaattc      1260
     atccatggtg tcaacaatca ggtcacctcg ttgctaaacc cttgcaaccc ctacgcaaat      1320
     atcagacagc cggttcacaa gagccgcatg gagttcgaac ttgatgtgct tgaaataatg      1380
     tgccgcgaca gaggacttga attcccaggg aacatcaatc agctagtgct ggctaacctg      1440
     ttccgagacc agtcggagcc ctgggctgac attgctcgag cccatgtaaa gaaatcatgg      1500
     gagacaatcc gggaattcgt gtcgctgttg atggatcatc ttgcggatga acacatgtct      1560
     gcggtgataa tacgaactgt tattcaacca cagttggata ggatgcatgc cagtctactg      1620
     ggcaaggtac ttgaattgac tgctgccaac aagcgaggcc atgcattgcc tctgagtcgg      1680
     agcttccttc ggggccatcc attgcctctc gatcgaagct ttcttgctag gatgcagaag      1740
     tccaggaacg atcgcgtgct ggcccacctg cagcagagcc ttccatcgag ccttccatca      1800
     aatttcagta ctacctacaa tatgggagaa attcgggcgg ctacccagag catggaatca      1860
     tcaagcaacc cattcgtcgc ttcggatctc atcgaccagt tccaggcata ttacaacaat      1920
     gctctaggtg tcttcacgga caacattacg accctcggaa tcgaaaattg cctcctcgac      1980
     cctctgaacg accttttgac cacgcggaaa atcaccgaaa tggaggacag ccaaatcgaa      2040
     gaccttttcg ctggtgtaca aaatggtgtg gaggaccagg gacacgatcc gggtgatgag      2100
     ctcaagctat tgcaaaccgc agtgcgagta ttggatcaat tcaagattgc gccatctacc      2160
     ggagcaatca aatcgcccgg attatcctca gcccatgggc gttcatctct ccaaccctac      2220
     ctcatccccc aagggatcat atgcaatggc gcatctgcca atcccttcgg cgtactgtgt      2280
     gtggattcta gagtccaagg ccagaacaac acgccccggt atcagatttc gtggccatac      2340
     agccaggcgc cagacatgca gaactcaacc acgccttgcc cgagtggtcc attcggcttg      2400
     aatcccggta ccatgaatcc tgggactgtg agtgttccgt ctgtatctgc cccgactgtg      2460
     aacgctgctc caacttccgg tgtacctgga ttcgctggac ctacacctcc gctcccccag      2520
     acagttacgt ctagcccgtt ctgctcgctc cgtgctggac ctgatctatt cggtacgcca      2580
     gataccagta gtcacgatgc gtaa                                             2604
//

If you have problems or comments...

PBIL Back to PBIL home page