(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE375

PENCW_16.PE375       Location/Qualifiers
FT   CDS_pept        join(860040..860188,860249..860510)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948890"
FT                   /orf_name="Pc20g03750"
FT                   /product="Putative uncharacterized protein Pc20g03750 "
FT                   /protein_id="CAP85704.1"
FT                   /db_xref="UniParc:UPI0001831202"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT8"
FT                   /transl_table=1
FT                   /translation="MDFVDDNDKVLGKAEVVSNYFGLSSLNALPKHLMGRIVSIATSST
FT                   SLVKRSPRVSRETAMSFLRTFRGLVNFVHLVFSSCPLSIAIHPSTLPGSIEAHLVGNLK
FT                   AKLLIGMDVMGHEAFRLDLDAKKTTELLMYGH"
     atggattttg tcgacgataa tgacaaggta ttaggcaagg ctgaagtagt ctcaaattat        60
     ttcggccttt cgtcgctcaa tgctttgccg aaacatctga tgggaagaat tgtcagcatt       120
     gcaacaagct ccacaagcct tgtgaaacgg tccccgaggg tgtcgagaga aaccgcgatg       180
     agcttcttgc gtacctttcg tgggctcgtg aattttgttc atctagtttt cagctcttgt       240
     cccctaagca tcgcgatcca cccctccacc cttccgggat caatcgaagc ccacttggtc       300
     ggcaatctaa aagctaagct gctgattggc atggatgtca tggggcatga agccttccgg       360
     ctagatcttg acgcgaaaaa aactacggag ctcctcatgt atggacattg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page