(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE376

PENCW_16.PE376       Location/Qualifiers
FT   CDS_pept        join(complement(862786..863698),complement(862307..862733),
FT                   complement(861967..862255),complement(861458..861907))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234989" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128993"
FT                   /orf_name="Pc20g03760"
FT                   /product="Pc20g03760 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85705.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831203"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGT9"
FT                   /transl_table=1
FT                   /translation="MSAPTTRRNRALASCEPCRERKSRCDHGKPICASCQRRGLDSRCY
FT                   YHPAPLSKNRSARRPTMLTLPRSTLATPSWSRNNTKGCQAHPGRSAAGPPKFHTWPFMS
FT                   TVSDTLPQTPTPGSHDSKAYEAHLATMKEIVSQLRYLPVIEKCLHQYYSFKHNALVPKP
FT                   VVLQILDTLRTDLVSSGHILGEKGEQVELGDISEISETVLLSSSTEVIITPSLDLHGFC
FT                   ALFCGANLRVETIGLLYTMAARASVFFVDRDEDKDGAFVQDMVWYSTLALRLARDLAPQ
FT                   STDVIIWLANENAELRSFLEGDASLGVWRLVGDLTTDLLALGLNREATYSPERTPFFLA
FT                   ECRRRCFVTEYYLEKMFGLVFNLPPRITSRYVDVKLPLDLSDDEIFAQTPEELEEAKDR
FT                   LTEDGWNTDGKLRAATYARLRYILSQFREGIVEYHFQASQAADPAQLRDLSSQCRQTWD
FT                   NLLPHLRYTQDCWESDMPFTTCYMHAKIHLAYLQIHFQIYHLLGEDSSSPLPELLDVSA
FT                   NILETVVQMGISRRKGAFTFNDLPLILLSCGLPSAAVLSTALENITQDPSRVLPPGIKT
FT                   PAVIRNLSVLASQLDSVASSRERNQAFCLQAAKAITEKLDKILDKFATSKFQATPDVAT
FT                   STDVSPMSVLATDVDSPLDDGAGEIGAINLDDYDNFDLMSWAIDFDLGNTASDWTMM"
     atgtcagcac cgacaaccag gcgcaatcgt gctctggcct catgtgaacc ttgtagagag        60
     agaaaaagtc gatgtgatca tggcaaacca atttgtgcct cctgccagcg tcgtgggctc       120
     gactctcgat gctattacca tcctgcgcct ctatctaaaa atcggagtgc acgaagaccg       180
     accatgctta cgctaccccg atcaaccctt gctacgccat catggagcag gaacaacaca       240
     aaaggctgcc aggcccatcc tggacggtct gcggctggtc cgcccaaatt tcacacatgg       300
     cctttcatgt cgaccgtctc tgacacgctg ccacaaacac ccacgccggg ctcgcatgac       360
     agcaaagctt atgaggccca cctagccacc atgaaggaga tcgtgtctca attgagatac       420
     ctcccagtca ttgagaagtg tctccatcaa tactactctt ttaagcataa cgcacttgta       480
     ccgaaaccag tcgttctgca aatcctggac accctccgta cggatctggt atcttcgggc       540
     catattcttg gagaaaaagg agagcaagtc gagctgggcg atatctcgga gatatcagaa       600
     actgtgctgc tctcttcctc tacagaggtc atcatcaccc catccttaga cctgcatggt       660
     ttctgcgcct tgttttgtgg cgcgaatctt cgggtcgaga ctatcggtct tttgtacact       720
     atggctgccc gtgcttcggt cttcttcgtt gaccgcgacg aggataagga tggcgcattt       780
     gtccaagaca tggtttggta tagtacattg gccttacgac tagctcgtga ccttgcacct       840
     cagtcgaccg acgtcatcat atggttggcg aatgaaaatg cggagctcag gtcatttctt       900
     gaaggagatg cgagcctcgg tgtgtggcgt ttggtgggcg atctcacaac ggatttattg       960
     gctttgggct tgaacagaga agcgacatat tcccccgaga gaactccgtt tttccttgca      1020
     gaatgccgga ggagatgctt tgtgactgaa tattatctcg agaaaatgtt cggcctggtg      1080
     ttcaatctac cacctcgcat tacctctcga tatgttgatg tcaagctccc cctcgatttg      1140
     tcagatgatg aaattttcgc tcaaaccccc gaggaactag aagaagcaaa agatcgactc      1200
     acagaagatg gctggaacac ggatgggaaa cttagggcag caacctatgc tcgactacga      1260
     tatattttaa gtcagtttcg ggaaggaatt gtggaatacc attttcaagc atcacaggca      1320
     gctgaccctg cccagctcag agatctgtct tctcaatgcc gtcagacttg ggataacctg      1380
     cttccccacc tgaggtatac ccaggattgt tgggaatctg acatgccttt taccacttgt      1440
     tatatgcatg caaagattca tctggcctac ctccaaatcc atttccagat ataccacctc      1500
     cttggagaag atagctcatc tccgcttccc gaactgcttg atgtgtctgc aaacatattg      1560
     gagacagttg tgcaaatggg aatttctcgc agaaaaggtg cctttacctt caatgatttg      1620
     cctctcatcc ttctgtcctg cggcttgccc tctgccgcag tcctttcgac tgcgctagaa      1680
     aatattacac aagatccttc aagagtcctt ccgcctggta taaagacgcc ggctgttatt      1740
     cggaatcttt cagtacttgc atcgcaactt gacagtgtgg ccagttcccg ggaaagaaat      1800
     caagcgttct gtttgcaggc tgcaaaagcc atcacagaga agttggacaa gatcctggac      1860
     aagtttgcaa catcaaagtt tcaggcaact ccagatgtcg cgacaagcac tgacgtgagc      1920
     ccgatgtcag ttctggccac tgatgttgac agtcccctcg atgatggagc tggcgagatt      1980
     ggtgctatca atctggatga ttacgataat tttgatctaa tgtcttgggc aatcgatttc      2040
     gacctgggaa acacggccag cgactggact atgatgtaa                             2079
//

If you have problems or comments...

PBIL Back to PBIL home page